ESTScan Details for Unigene SGN-U238466

Score 
397
Direction 
Forward
Predicted Peptide Sequence 
MEAKTAVSLNAMIDGYARNGYHDEALIIFQKMLDEGFKPTNVTIMSTLHACAETRNIELGQYVHKLVNQLGLGSNVAVVNSLISMYCKCQ
RVDIAAELFENLKGKTLVSWNALILGYAQNGCVMDALTHFCEMHLQNITPDSFTMVSVVTALAEXNQYNAKLSGYMDLLKNX
Predicted Coding Sequence 
ATGGAGGCTAAGACGGCTGTATCATTGAATGCTATGATAGATGGATATGCACGGAATGGATATCACGATGAAGCTCTTATCATCTTTCAG
AAAATGTTGGATGAAGGATTCAAACCAACGAATGTGACTATTATGAGCACTTTACATGCGTGTGCTGAAACAAGGAATATTGAGCTTGGA
CAATATGTTCACAAACTGGTCAACCAACTAGGTCTTGGTTCTAATGTTGCAGTTGTTAACTCGTTGATTTCAATGTATTGCAAGTGCCAA
AGAGTGGATATTGCAGCTGAATTGTTCGAAAACTTGAAAGGAAAAACACTTGTTTCATGGAATGCTTTGATTTTGGGCTATGCACAAAAT
GGATGTGTAATGGATGCATTAACTCATTTTTGTGAAATGCATCTGCAGAACATCACACCTGATTCATTTACAATGGTAAGTGTTGTTACT
GCTCTTGCTGAGXTTAATCAGTATAACGCCAAGCTAAGTGGATACATGGATTTGCTGAAGAACTTX\
Edits in Original Sequence 
GCTAAATGTGGGTCAGTGTTCACTGCTTGGTTGGTTTTTGATA(5')ATGGAGGCTAAGACGGCTGTATCATTGAATGCTATGATAGATG
GATATGCACGGAATGGATATCACGATGAAGCTCTTATCATCTTTCAGAAAATGTTGGATGAAGGATTCAAACCAACGAATGTGACTATTA
TGAGCACTTTACATGCGTGTGCTGAAACAAGGAATATTGAGCTTGGACAATATGTTCACAAACTGGTCAACCAACTAGGTCTTGGTTCTA
ATGTTGCAGTTGTTAACTCGTTGATTTCAATGTATTGCAAGTGCCAAAGAGTGGATATTGCAGCTGAATTGTTCGAAAACTTGAAAGGAA
AAACACTTGTTTCATGGAATGCTTTGATTTTGGGCTATGCACAAAATGGATGTGTAATGGATGCATTAACTCATTTTTGTGAAATGCATC
TGCAGAACATCACACCTGATTCATTTACAATGGTAAGTGTTGTTACTGCTCTTGCTGAGXTTAATCAGTATAACGCCAAGCTAAGTGGAT
ACATGGATTTGCTGtAAGAACTTX\(3')TT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan