ESTScan Details for Unigene SGN-U238520

Score 
513
Direction 
Forward
Predicted Peptide Sequence 
HFAPLTESFSIQLPPWGQKSYTPNMISGTSQANIGXIGMNGYLLPLNSMGVYEFYLWVSEVTQIFDLAILKVISARKNELETGYERGGQT
REDVQLATTLGVSKLLLVVNKMDDPTVVWSKERDPMKNDTILKIISNNVKKDVQFLPISGLLGSNMKTWVEEGICEWWDGPCLFEAFDAV
EVPLQDPEGPLSKAHPAVTEFVAELQIFGAVFNAIFTAGYXAVVHIHVIVEEWRLLTDAAIDIKK
Predicted Coding Sequence 
CATTTCGCTCCTCTAACGGAATCCTTTTCTATTCAGCTTCCGCCATGGGGTCAGAAGAGTTACACCCCGAATATGATTAGTGGAACATCT
CAAGCCAACATAGGTGXTATTGGTATGAATGGTTACCTTTTGCCATTGAACTCCATGGGAGTTTATGAATTCTATCTATGGGTTTCGGAA
GTTACACAGATCTTTGATTTGGCTATTCTGAAGGTTATATCCGCTAGAAAGAATGAACTCGAAACTGGATATGAAAGAGGTGGACAAACA
CGTGAAGATGTTCAACTTGCAACGACGCTAGGAGTTTCTAAGCTCCTTCTTGTTGTAAATAAGATGGATGATCCTACTGTCGTCTGGTCT
AAAGAAAGAGATCCAATGAAAAATGATACCATTCTTAAAATCATCTCAAACAATGTAAAGAAAGATGTTCAGTTCCTGCCAATCTCTGGT
CTCCTAGGTTCAAATATGAAAACTTGGGTGGAGGAAGGAATATGCGAATGGTGGGATGGTCCATGCCTTTTTGAAGCTTTTGATGCGGTA
GAAGTTCCTCTGCAAGATCCTGAAGGTCCACTAAGCAAAGCCCATCCTGCAGTTACTGAGTTTGTTGCAGAGTTACAGATCTTTGGAGCT
GTTTTCAATGCTATTTTTACTGCTGGCTACNNAGCTGTNGTGCATATTCATGTTATTGTTGAGGAATGGAGATTGTTGACTGATGCAGCA
ATTGATATCAAGAAA\
Edits in Original Sequence 
(5')CATTTCGCTCCTCTAACGGAATCCTTTTCTATTCAGCTTaCCGCCATGGGGTCAGAAGAGTTACACCCCGAATATGATTAGTGGAA
CATCTCAAGCCAACATAGGTGXTATTGGTATGAATGGTTACCTTTTGCCATTGAACTCCATGGGAGTTTATGAATTCTATCTATGGGTTT
CGGAAGTgTACACAGATCTTTGATTTGGCTATTCTGAAGGTTATATCCGCTAGAAAGAATGAACTCGAAACTGGATATGAAAGAGGTGGA
CAAACACGTGAAGATGTTCAACTTGCAACGACGCTAGGAGTTTCTAAGCTCCTTCTTGTTGTAAATAAGATGGATGATCCTACTGTCGTC
TGGTCTAAAGAAAGAGATCCAATGAAAAATGATACCATTCTTAAAATCATCTCAAtACAATGTAAAGAAAGATGTTCAGTTCCTGCCAAT
CTCTGGTCTCCTAGGTTCAAATATGAAAACTTGGGTGGAGGAAGGAATATGCGAATGGTGGGATGGTCCATGCCTTTTTGAAGCTTTTGA
TGCGGTAGAAGTTCCTCTGCAAGATCCTGAAGGTCCACTAAGCAAAGCCCATaCCTGCAGTTACTGAGTTTGTTGCAGAGTTACAGATCT
TTGGAGCTGTTgTTCAATGCTATTTTTACTGCTGGCTACNNAGCTGTNGTGCATATTCATGTTATTGTTGAGGAATGcGAGATTGTTGAC
TGATGCAGCAATTGATATCAAGAAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan