ESTScan Details for Unigene SGN-U238541

Score 
306
Direction 
Forward
Predicted Peptide Sequence 
VEVFALRAEKLKVVANQFNASIVKNYNMHFDTTHTNGGRGELAIYKLHGXRHRRKILGEELSREESLYYRGGMDQDDNYGREYPEAGGNA
SDQATESSTQQLGVLASRFAANTRRGKTGGRVDSGESSLRMPKLFKPDEPDFSHDPSS
Predicted Coding Sequence 
AXAGTTGAAGTATTTGCACTTAGAGCTGAAAAGCTCAAGGTTGTCGCAAACCAGTTCAACGCCTCCATAGTAAAAAACTACAACATGCAT
TTCGATACTACTCACACCAATGGAGGACGTGGGGAGCTTGCTATATACAAGCTGCATGGAGAXCGCCATAGGAGGAAAATACTAGGGGAA
GAATTATCAAGAGAAGAGAGCTTGTACTACAGGGGAGGGATGGACCAAGATGACAATTATGGTCGTGAATATCCAGAAGCTGGTGGTAAT
GCTTCGGATCAGGCAACAGAAAGCAGTACTCAGCAACTTGGAGTATTGGCATCAAGATTTGCTGCTAATACCAGAAGAGGCAAGACGGGG
GGACGTGTGGACTCTGGTGAATCCAGCTTACGTATGCCTAAACTTTTTAAGCCTGACGAGCCTGATTTTTCTCATGATCCTAGTAGTTGA
\
Edits in Original Sequence 
(5')AXAGTTGAAGTATTTGCACTTAGAGCTGAAAAGCTCAAGGTTGTCGCAAACCAGTTCAgACGCCTCCATAGTAAAAAACTACAACA
TGCATTTCGATACTACTCACACCAATGGAGGACGTGGGGAGCTTGCTATATACAAGCTGCATGGAGAXCGCCATAGGAGGAAAATACTAG
GGGAAGAATTATCAAGAGAAGAGAGCTTGTACTACAGGGGAGGGATGGACCAAGATGACAATTATGGTCGTGAATATCCAGAAGCTGGTG
GTAATGCTTCGGATCAGGCAACAGAAAGCAGTACTCAGCAACTTGGAGTATTGGCATCAAGATTTGCTGCTAATACCAGAAGAGGCAAGA
CGGGGGGACGTGTGGACTCTGGTGAATCCAGCTTACGTATGCCTAAACTTTTTAAGCCTGACGAGCCTGATTTTTCTCATGATCCTAGTA
GTTGA\(3')AATCGCGAGTTCTGGTTTTTGGGTTGGAGTTGGTAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan