ESTScan Details for Unigene SGN-U238553

Score 
-40
Direction 
Reverse
Predicted Peptide Sequence 
DSSDVELVKLMVMGEGLNLDESIALHYAVENCSREVVKALLELGAANVNHPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTMDGI
TPLDILQTLTSDFLFKGAIPGLTHIEPNKLRLCLXVSSSREITIX
Predicted Coding Sequence 
XTAGACTCATCCGACGTGGAATTGGTCAAACTTATGGTCATGGGAGAAGGACTAAATCTCGATGAATCGATCGCGTTACACTACGCGGTC
GAGAATTGTAGCCGGGAGGTTGTGAAAGCGTTACTCGAGCTCGGTGCAGCCAACGTGAACCACCCGGCCGGTCCAGCTGGCAAAACCCCC
CTCCACATTGCATCGGAAATGGTGTCACCCGACATGGTGGCAGTCCTACTAGACCACCACGCAGATCCAAATGTCAGAACGATGGATGGG
ATCACTCCACTCGACATTCTACAAACCCTAACTTCCGATTTCTTATTCAAAGGTGCGATCCCTGGTCTAACTCATATCGAACCAAACAAA
CTACGTCTATGTCTTGXAGTTTCTTCCTCTCGTGAAATTACCATAGXX\
Edits in Original Sequence 
(5')XTAGACTCATCCGACGTGGAATTGGTCAAACTTATGGTCATGGGAGAAGGACTAAATCTCGATGAATCGATCGCGTTACACTACGC
GGTCGAGAATTGTAGCCGGGAGGTTGTGAAAGCGTTACTCGAGCTCGGTGCAGCCAACGTGAACCACCCGGCCGGTCCAGCTGGCAAAAC
CCCCCTCCACATTGCATCGGAAATGGTGTCACCCGACATGGTGGCAGTCCTACTAGACCACCACGCAGATCCAAATGTCAGAACGATGGA
TGGGATCACTCCACTCGACATTCTACAAACCCTAACTTCCGATTTCTTATTCAAAGGTGCGATCCCTGGTCTAACTCATATCGAACCAAA
CAAACTACGTCTATGTCTTGXAGTTTCTTCCTCTCGTGAAATTACCATAGXX\(3')ACCATAGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan