ESTScan Details for Unigene SGN-U238558

Score 
342
Direction 
Reverse
Predicted Peptide Sequence 
SKNAAVTALAVDPSSNFLYXGSSDGLVNFWQGDKLLSHGGVLRGHKLATLCLAAAGNLIFSGSADNNICVWKRDGAEHMCLSVLSGHSGP
VKCLAVEEEQQQKGSDKQFIVYSGSLDKSVKIWRISSQLVPNQAEVGMSPPQNFPHQIAAELPKEKIAMETFDNCIDAASFGN
Predicted Coding Sequence 
AGCAAGAATGCXGCTGTAACAGCTTTAGCTGTTGACCCTTCATCCAATTTCCTATATNGTGGCTCTTCAGATGGGCTAGTCAATTTTTGG
CAAGGCGACAAGCTTCTATCTCATGGAGGAGTGTTAAGGGGTCATAAACTTGCAACACTCTGTTTAGCAGCGGCGGGGAATTTAATTTTC
AGTGGATCAGCTGATAACAATATTTGCGTGTGGAAAAGGGACGGAGCAGAACATATGTGTTTATCAGTGTTGAGCGGACATTCTGGTCCG
GTTAAATGCTTGGCTGTTGAAGAGGAACAACAACAAAAAGGTAGTGATAAACAATTTATTGTTTACAGCGGGAGCCTCGATAAATCAGTG
AAGATTTGGAGGATATCGTCGCAGTTGGTACCAAATCAGGCGGAAGTGGGGATGAGTCCACCGCAAAATTTTCCTCATCAAATAGCTGCA
GAGTTGCCAAAGGAGAAAATAGCAATGGAGACTTTTGACAATTGTATAGACGCAGCTAGCTTTGGAAATTGA\
Edits in Original Sequence 
(5')AGCAAGAATGCXGCTGTAACAGCTTTAGCTGTTGACCCTTCATCCAATTTCCTATATNGTGGCTCTTCAGATGGGCTAGTCAATTT
TTGGCAAGGCGACAAGCTTCTATCTCATGGAGGAGTGTTAAGGGGTCATAAACTTGCAACACTCTGTTTAGCAGCGGCGGGGAATTTAAT
TTTCAGTGGATCAGCTGATAACAATATTTGCGTGTGGAAAAGGGACGGAGCAGAACATATGTGTTTATCAGTGTTGAGCGGACATTCTGG
TCCGGTTAAATGCTTGGCTGTTGAAGAGGAACAACAACAAAAAGGTAGTGATAAACAATTTATTGTTTACAGCGGGAGCCTCGATAAATC
AGTGAAGATTTGGAGGATATCGTCGCAGTTGGTACCAAATCAGGCGGAAGTGGGGATGAGTCCACCGCAAAATTTTCCTaCATCAAATAG
CTGCAGAGTTaGCCAAAGGAGAAAATAGCAATGGAGACTTTTGACAATTGTATAGACGCAGCTAGCTTTGGAAATTGA\(3')CCAAGTA
AGAAATTATCTACATGTTTTGCTAGCTTTGCAGAGAAATTTGTAAATGAAAACTTTATTTGTATTTTCACCCATTGGAGTTCGACACAAA
TGTCAATGGCTGTTGATGTATTTGAATTTGCTCTTGTTTCCGTCTATTTGACTGACAACAAAGTAACAAACAGATGAGTTATCTACATTT
CTTGTATAGTATCATGATCATCTTCATTTCTATTCCCCATATGTAACTTGACACTTCAATGTGAAATCTCTTAATTGAACG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan