ESTScan Details for Unigene SGN-U238583

Score 
361
Direction 
Forward
Predicted Peptide Sequence 
SLFRFTEMVQMLEVILYCEDVAEAFEVVLHRGDVGHVYNIGTNKERRVIDVAKDISNLFNKDPDTSIQFVENRPFNDQRYFLDDQKLKNL
GWSEKTTWEEGLKKTMEWYVNNPDWWGDVSXALLPHPTMLMMPGGVERNSDGAEKGDSGSSX
Predicted Coding Sequence 
AGCCTCTTTCGATTCACGGAGATGGTTCAAATGTTAGAAGTTATTCTCTATTGTGAGGACGTTGCTGAAGCTTTCGAAGTTGTTCTTCAC
CGAGGTGATGTTGGTCATGTTTATAACATCGGGACTAACAAAGAGAGGCGAGTGATTGATGTTGCCAAAGATATATCCAATCTTTTTAAC
AAGGATCCAGACACAAGCATTCAGTTTGTGGAAAACAGGCCCTTCAATGACCAGAGGTATTTCTTAGATGATCAGAAGTTGAAGAACCTC
GGTTGGTCAGAGAAGACCACCTGGGAAGAGGGTCTGAAAAAAACCATGGAGTGGTATGTCAACAATCCTGATTGGTGGGGAGATGTCTCA
NGGGCATTGCTTCCCCATCCTACAATGCTGATGATGCCTGGTGGGGTAGAGAGAAATTCGGATGGAGCTGAAAAAGGTGATTCTGGATCA
TCTGXX\
Edits in Original Sequence 
(5')AGCCTCTTTCGATTCACGGAGATGGTTCAAATGTTAGAAGTTATTCTCTATTGTGAGGACGTTGCTGAAGCTTTCGAAGTTGTTCT
TCACCGAGGTGATGTTGGTCATGTTTATAACATCGGGACTAACAAAGAGAGGCGAGTGATTGATGTTGCCAAAGATATATCCAATCTTTT
TAACAAGGATCCAGACACAAGCATTCAGTTTGTGGAAAACAGGCCCTTCAATGACCAGAGGTATTTCTTAGATGATCAGAAGTTGAAGAA
CCTCGGTTGGTCAGAGAAGACCACCTGGGAAGAGGGTCTGAAAAAAACCATGGAGTGGTATGTCAACAATCCTGATTGGTGGGGAGATGT
CTCANGGGCATTGCTTCCCCATCCTACAATGCTGATGATGCCTGGTGGGGTAGAGAGAAATTCGGATGGAGCTGAAAAAGGTGATTCTGG
ATCATCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan