ESTScan Details for Unigene SGN-U238590

Score 
134
Direction 
Reverse
Predicted Peptide Sequence 
LGMGDVGREEMIGEAARDKDGRMDSKEFVVRRQKGNPGLGGGKKGLEQSFTMGFGEALKL
Predicted Coding Sequence 
XXATTGGGCATGGGGGATGTTGGAAGGGAGGAAATGATCGGGGAAGCTGCCCGGGACAAGGACGGACGTATGGATTCCAAGGAGTTTGTT
GTTAGGAGGCAAAAGGGAAATCCAGGGCTTGGGGGGGGCAAGAAAGGTTTAGAGCAAAGTTTCACCATGGGATTCGGGGAAGCACTAAAA
CTATAG\
Edits in Original Sequence 
(5')XXATTGGGCATGGGGGATGTTGGAAGGGAGGAAATGATCGGGGAAGCTGCCCGGGACAAGGACGGACGTATGGATTCCAAGGAGTT
TGTTGTTAGGAGGCAAAAGGGAAATCCAGGGCTTGGGGGGGGCAAGAAAGGTTTAGAGCAAAGTTTCACCATGGGATTCGGGGAAGCACT
AAAACTATAG\(3')TGGGGGGGGCAAGAAAGGTTTAGAGCAAAGTTTCACCATGGGATTCGGGGAAGCACTAAAACTATAGGTTTTGGA
AGGGTTTTTTTTGTTCCTTTGGGGTGGTTTGGACGGGGGATACGGTTTTTTTATTAGTTTTTTCATTGGAATATTTGGGTTTTTAAAGGG
TGTATGGTATTTAAATTAGTTTTGTTAAACGGATGGTTATTTTCCAGTTCAATTTTCAGTTCATTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan