ESTScan Details for Unigene SGN-U238600

Score 
97
Direction 
Forward
Predicted Peptide Sequence 
DNLVSAVSKLTTSDSPSAISFGRSRARGLSFVPRAVNRQRGPVTSTGGXKKLVACQWNLEASENXQAHVKKDMIEADWLQHNVVMVPTVK
PLLFMACSNFFGCLVKGCHTSGGCN
Predicted Coding Sequence 
GACAATCTCGTTTCAGCGGTATCGAAATTAACCACTTCGGATTCTCCTTCAGCAATCAGCTTTGGCCGCAGTAGGGCTCGTGGATTGTCA
TTTGTGCCTCGTGCAGTTAATCGGCAGAGAGGACCAGTCACCTCAACCGGTGGAAXCAAAAAACTAGTGGCATGCCAATGGAATCTTGAA
GCATCTGAAAATGXTCAGGCTCATGTTAAGAAAGATATGATTGAAGCTGATTGGCTACAACACAATGTGGTGATGGTTCCAACTGTTAAA
CCACTGCTCTTTATGGCATGCTCAAATTTTTTTGGATGTCTTGTCAAAGGTTGTCACACCTCTGGTGGCTGCAATTAA\
Edits in Original Sequence 
(5')GACAATCTCGTTTCAGCGGTATCGAAATTAACCACTTCGGATTCTCCTTCAGCAATCAGCTTTGGCCGCAGTAGGGCTCGTGGATT
GTCATTTGTGCCTCGTGCAGTTAATCGGCAGAGAGGACCAGTCACCTCAACCGGTGGAAXCAAAAAACTAGTGGCATGCCAATGGAATCT
TGAAGCATCTGAAAATGXTCAGGCTCATGTTAAGAAAGATATGATcTGAAGCTGATTGGCTACAACACAATGTGGTGATGGTTCCAACgT
GTTAAACCACTGCTCTTTATGGCATGCTCAAATTTTTTTGGATGTCTTGTCAAAGGTTGTCACACCTCTGGTGGCTGCAATTAA\(3')A
AGAGAACTAAGTTTTTCTCCTATCATGCCCAAACATGTCTAATTTTTCTTGTTAATGAATTATAGAAAAGATTGTGGTTTTCATACTAAA
GCAATTAGCAGATATCAATCCAATTAGTTGGTTATATCTCAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan