ESTScan Details for Unigene SGN-U238601

Score 
212
Direction 
Reverse
Predicted Peptide Sequence 
HNEVDLGKXAAQRVLELEPQDETTYVLLSNMYATSKGGNNVAFVRKTMKKKRLKKEPGLSWVENQGSVHYFSVGDASHPDIKLIHGMLEW
LNLKSKGGGYVPNSDVILLDVDDDEKYASYGYIVRDXALAFALVRMPPGSPIRIIKNLRICLDCHAAIKFISTLVQREIVIRDINGFTTS
KVELVHVVITGNIPQLLAYMYPSXMKLACFGLLRTDADKMKA
Predicted Coding Sequence 
XXTCATAATGAAGTTGATCTTGGAAAAXCAGCTGCTCAGCGTGTGCTTGAATTGGAACCACAAGATGAAACAACGTATGTGTTGTTATCA
AATATGTATGCCACTTCAAAAGGTGGGAATAATGTAGCTTTTGTCCGGAAAACTATGAAGAAAAAACGACTAAAGAAGGAACCAGGACTT
AGTTGGGTTGAAAACCAGGGCAGTGTTCATTATTTCTCTGTTGGTGATGCTTCACATCCTGATATCAAACTTATACACGGAATGTTGGAA
TGGCTCAACTTGAAAAGTAAGGGGGGAGGCTATGTTCCTAATTCTGATGTTATTCTACTTGATGTGGACGATGATGAAAAATACGCCTCC
TATGGTTACATAGTGAGAGATXTAGCTTTAGCCTTTGCTTTAGTAAGAATGCCGCCTGGAAGCCCGATTCGGATTATTAAAAATCTACGA
ATATGTTTGGACTGTCATGCAGCAATCAAATTTATATCAACTCTTGTGCAGCGAGAAATTGTTATAAGAGATATAAATGGTTTCACCACT
TCCAAAGTGGAGCTTGTTCATGTGGTGATTACTGGTAATATACCTCAGCTCCTGGCTTATATGTATCCATCTAXAATGAAACTTGCCTGT
TTTGGCCTCTTAAGGACTGATGCTGATAAAATGAAGGCTTAA\
Edits in Original Sequence 
(5')XXTCATAATGAAGTTGATCTTGGAAAAXCAGCTGCTCAGCGTGTGCTTGAATTGGAACCACAAGATGAAACAACGTATGTGTTGTT
ATCAAATATGTATGCCACTTCgAAAAGGTGGGAATAATGTAGCTTTTGTCCGGAAAACTATGAAGAAAAAACGACTAAAGAAGGAACCAG
GACTTAGTTGGGTTGAAAACCAGGGCAGTGTTCATTATTTCTCTGTTGGTGATGCTTCACATCCTGATATCAAACTTATACACGGAATGT
TGGAATGGCTCAACTTGAAAAGTAAGGGGGGAGGCTATGTTCCTAATTCTGATGTTATTCTACTTGATGTGGACGATGATGAAAAgATAC
GCCTCCTATGGTTACATAGTGAGAGATXTAGCTTTAGCCTTTGCTTTAGTAAGAATGCCGCCTGGAAGCCCGATTCGGATTATTAAAAAT
CTACGAATATGTTTGGACTGTCATGCAGCAATCAAATTTATATCAACTCTTGTGCAGCGAGAAATTGTTATAAGAGATATAAATaGGTTT
CACCACTTCCAAAGTGGAGCTTGTTCATGTGGTGATTACTGGTAATATACCTCAGCTCCTaGGCTTATATGTATCCATCTAXAATGAAAC
TTGCCTGTTTTGGCCTCTTAAGGACTGATGCTGATAAAATGAAGGCTTAA\(3')AGCATCCACAACTATTTAAAGTTGTATGCCTATTT
TAATTAGACACTTCAACCAACCTTATTTCCTATTAACACTTGATCAAAAGAGGAGAGTGTGTATAATGCACATGCACATGATGTGACAAA
CTATTAAATCAAATAAAGACACCATGACATTTCAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan