ESTScan Details for Unigene SGN-U238789

Score 
269
Direction 
Forward
Predicted Peptide Sequence 
PAALLNFGTHVKKKESKLYGAHFREIDANAPKATKIKFGDSDKKIEKTNINCASLSLSCSSSVAQLLXIGSKLHRPDTTESFGGYTAVVD
RCEKSARDDVPQLCAHV
Predicted Coding Sequence 
XXTCCAGCTGCCCTTCTTAACTTTGGAACCCATGTAAAGAAAAAGGAGTCCAAGCTCTATGGTGCTCATTTTAGAGAAATTGACGCAAAT
GCTCCAAAGGCCACCAAAATAAAATTTGGTGATTCTGATAAGAAGATTGAGAAAACGAATATCAATTGTGCCAGTTTGTCATTGAGTTGT
AGCAGCAGTGTAGCACAACTCCTTTGAATTGGTTCCAAGCTTCACCGTCCTGACACTACAGAATCATTTGGTGGATACACXGCAGTAGTG
GATCGTTGTGAGAAGAGTGCAAGAGATGATGTCCCACAGCTATGTGCTCATGTCTAA\
Edits in Original Sequence 
(5')XXTCCAGCTGCCCTTCTTAACTTTGGAACCCATGTAAAGAAAAAGGAGTCCAAGCTCTATGGTGCTCATTTTAGAGAAATTGACGC
AAATGCTCCAAAGGCCACCAAAATAAAATTTGGTGATTCTGATAAtGAAGATTGAGAAAACGAATATCAATTGTGCCAGTTTGTCATTGA
GTTGTAGCAGCAGTGTAGCACAACTCCTTTGAATTGGTTCCAAGCTTCACCGTCCTGACACTACAGAATCATTTGGTGGATACACXGCAG
TAGTGGATCGTTGTGAGAAGAGTGCAAGAGATGATGTCCCACAGCTATGTGCTCATGTCTAA\(3')AATTTATTGCACTGCAGTGTTCT
AGATAATAGTGTTTTAGAATCTTACTATTCTTTTATGTAATTCGTTTCATTACCAGAATACAAATGTTAACTCTTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan