ESTScan Details for Unigene SGN-U239254

Score 
199
Direction 
Forward
Predicted Peptide Sequence 
SLKVRRAGRSRRKTRFTGSKMSKSENPSTNPWPYHHSFVSSIFSNLLLLSKVLTFAALSPNGSLNYAKRVLTQIPNPSIFSYNSLIRGFL
ESHTASNEPLFIFKKLVKRNYPKTNSFTLAFVLKSCSILAAFDEGQQVHKHVVQSGFGS
Predicted Coding Sequence 
TCACTCAAAGTTCGAAGAGCTGGAAGAAGTAGAAGAAAGACTCGTTTCACTGGTTCAAAAATGTCCAAATCTGAGAATCCTTCAACAAAT
CCATGGCCATATCATCACTCATTCGTTTCTTCCATCTTCAGCAATCTCCTTCTTCTCTCAAAAGTTCTCACTTTTGCAGCTCTTTCACCC
AATGGCAGCCTCAATTACGCCAAACGGGTCCTTACCCAAATCCCAAATCCTAGTATATTTTCATATAATTCTCTCATTAGAGGTTTTCTT
GAATCCCATACCGCTTCTAACGAACCCCTTTTCATATTCAAGAAATTGGTCAAGAGAAACTACCCGAAAACGAATAGTTTCACTTTGGCG
TTTGTGTTGAAGTCGTGTTCTATTTTGGCGGCGTTTGATGAGGGGCAACAAGTGCATAAGCATGTTGTTCAATCTGGGTTTGGATCG\
Edits in Original Sequence 
(5')TCACTCAAAGTTCGAAGAGCTGGAAGAAGTAGAAGAAAGACTCGTTTCACTGGTTCAAAAATGTCCAAATCTGAGAATCCTTCAAC
AAATCCATGGCCATATCATCACTCATTCGTTTCTTCCATCTTCAGCAATCTCCTTCaTTCTCTCAAAAGTTCTCACTTTTGCAGCTCTTT
CACCCAATGGCAGCCTCAATTACGCCAAACGGGTCCTTACCCAAATCCCAAATCCTAGTATATTTTCATATAATTCTCTCATTAGAGGTT
TTCTTGAATCCCATACCGCTTCTAACGAACCCCTTTTCATATTCAAGAAATTGGTCAAGAGAAACTACCCGAAAACGAATAGTTTCACTT
TGGCGTTTGTGTTGAAGTCGTGTTCTATTTTGGCGGCGTTTGATGAGGGGCAACAAGTGCATAAGCATGTTGTTCAATCTGGGTTTGGAT
CG\(3')CG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan