ESTScan Details for Unigene SGN-U239485

Score 
129
Direction 
Reverse
Predicted Peptide Sequence 
MKLKHEILIQVTLETWPHXPMTVLNHYTDLTGFGFQMTKGLSMIARIVNIQVIEATKADNIFRHQQE
Predicted Coding Sequence 
ATGAAGCTCAAGCATGAAATTTTAATTCAGGTAACACTGGAGACCTGGCCTCATGXTCCAATGACTGTTCTTAATCACTACACAGATCTC
ACGGGTTTTGGTTTCCAGATGACCAAAGGGTTGAGTATGATTGCAAGGATTGTGAATATACAAGTGATAGAAGCAACCAAAGCTGATAAC
ATCTTTAGGCATCAACAGGAGTAA\
Edits in Original Sequence 
AGTGAAACAAAGAAGCATGAACTTCATTATTTGCACCCAAAATCGCATAACATGAGCTGCACCATTCCACGAAACAAGTAATACTAATAT
AGCTTATAAAGAAGGTATTCAAAAGAGAACTGGAAGTAAGAGAACCCAGAAAAAGACCCATGGTTAACTATTCTTTTTGAAACTGGTAAC
TTTAAACCCATGGTTAACTATCAACTAGATACTCCTTGGAGGATATTTTATTTTCTTTAGCTGTAACTTGAACGATGAAGCTCAAGCATG
AAATT
(5')ATGAAGCTCAAGCATGAAATTTTAATTCAGGTAACACTGGAGACCTGGCCTCATGXTCCAATGACTGTTCTTAATCACTAC
ACAGATCTCACGGGTTTTGGTTTCCAGATGACCAAAGGGTTGAGTATGATTGCAtAGGATTGTGAATATACAAGTGATAGAAGCAACCAA
AGCTGATAACATCTTTAGGCATCAACAGGAGTAA\(3')ATTATTTTAAGCAACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan