ESTScan Details for Unigene SGN-U239515

Score 
232
Direction 
Forward
Predicted Peptide Sequence 
FGILANTEHYIYMVKLLGMEGQLREAYELVQSLQEPIDSGIWGALLSCCDAHRNYELADIVACRLFGNKLENSSYRIMLSNMYASDGRWD
LVNKLRVDSEITKLKLPGKSWITSKXNIPLKGTLEVSSVTSFTELTVAESGSEAVRGGGIDLIVLSQRECYHVIPXTNGKEDEFDHSALN
LNDS
Predicted Coding Sequence 
TTTGGCATCTTAGCTAACACTGAACATTATATTTACATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACTTGTT
CAGTCACTGCAAGAACCAATTGACTCCGGCATTTGGGGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGCAGATATT
GTAGCTTGTCGTCTTTTTGGGAATAAGCTAGAGAATAGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAGGTGGGAT
TTGGTAAATAAGTTGAGAGTAGATTCTGAGATAACAAAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACATTCCTTTG
AAAGGAACTCTTGAGGTGTCTTCTGTGACATCTTTCACXGAGTTAACAGTTGCTGAATCTGGATCAGAAGCTGTGAGAGGAGGTGGGATC
GATCTAATTGTCTTGTCACAAAGGGAATGTTATCATGTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGATCATTCTGCACTCAAC
TTAAATGATTCT\
Edits in Original Sequence 
(5')TTTGGCATCTTAGCTAACACTGAACATTATATTTACATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACT
TGTTCAGTCACTGCAAGAACCAATTGACTCCGGCATTTGGGGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGCAGA
TATTGTAGCTTGTCGTCTTTTTGGGAATAAGCTAGAGAATAGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAGGTG
GGATTTGGTAAATAAGTTGAGAGTAGATTCTGAGATAACAAAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACATTCC
TTTGAAAGGAACTCTTGAGGTGTCTTCTGTGACATCTTTCACXGAGTTAACAGTTGCTGAATCTaGGATCAGAAGCTGTGAGAGGAGGTG
GGATCGATCTAATTGTCTTGTCACAAAGGGAATGTTATCATGTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGAcTCATTCTGCA
CTCAACTTAAATGATTCT\(3')CTAANCAGTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan