ESTScan Details for Unigene SGN-U239648

Score 
269
Direction 
Reverse
Predicted Peptide Sequence 
RXVYLDEPSTGLDPASRDTLWTVVKNARKGRAIILTTHSMEEADYLCDRLGIFVDGSLQCIANSSELKTRYGGSYVLAITTSADNEVEVE
KMVRQICPNANKVYHLSGTQKFELPKHESKIADVFQLVENAKSRFPIYAWGMADTTLEDVFIKVAACAQSFNEA
Predicted Coding Sequence 
AGGXTTGTCTACCTGGATGAGCCGAGTACTGGACTTGATCCAGCTTCAAGAGATACCTTATGGACTGTTGTGAAGAATGCACGGAAAGGC
AGAGCGATAATTCTCACTACCCATTCAATGGAAGAAGCGGATTATTTATGTGATCGCTTAGGAATCTTCGTTGATGGAAGCTTGCAATGC
ATAGCAAATTCATCAGAGTTGAAGACAAGATATGGAGGGTCTTACGTGCTCGCGATAACTACATCAGCTGATAATGAGGTGGAAGTGGAG
AAAATGGTGCGACAGATATGCCCAAATGCCAACAAAGTGTATCATTTATCAGGTACACAGAAGTTCGAGTTGCCAAAACATGAATCGAAA
ATTGCAGATGTATTTCAACTAGTTGAGAATGCAAAGAGTAGATTTCCAATTTATGCTTGGGGTATGGCTGATACAACTTTAGAGGATGTT
TTTATCAAGGTTGCTGCTTGTGCTCAATCCTTTAATGAAGCATGA\
Edits in Original Sequence 
(5')AGGXTTGTCTACCTGGATGAGCCGAGTACTGGACTTGATCCAGCTTCAAGAGATACCTTATGGACTGTTGTGAAGAATGCACGGAA
AGGCAGAGCGATAATTCTCACTACCCATTCAATGGAAGAAGCGGATTATTTATGTGATCGCTTAGGAATCTTCGTTGATGGAAGCTTGCA
ATGCATAGCAAATTCATCAGAGTTGAAGACAAGATATGGAGGGTCTTACGTGCTCGCGATAACTACATCAGCTGATAATGAGGTGGAAGT
GGAGAAAATGGTGCGACAGATATGCCCAAATGCCAACAAAGTGTATCATTTATCAGGTACACAGAAGTTCGAGTTGCCAAAACATGAATC
GAAAATTGCAGATGTATTTCAACTAGTTGAGAATGCAAAGAGTAGATTTCCAATTTATGCTTGGGGTATGGCTGATACAACTTTAGAGGA
TGTTTTTATCAAGGTTGCTGCTTGTGCTCAATCCTTTAATGAAGCATGA\(3')GGTTGCTGCTTGTGCTCAATCCTTTAATGAAGCATG
ATCATAACATTCAACCACAAATTCGAAGGAAAAAAAAAAGAAAGAAGGATCATATGTGCATAATGTTTTTTTTTTTGCCTTAATTAGGAA
ATATTTAGGTTCATGTAGATATATCAAGTACAGAGCAAATGTGACTCCTATTTTGTCATGTAAATTGTGTACAATGATGCCAATCTCTGG
CGTTTTGTTCGTGGAATAGAAAGAGTTTGTTGTATCAACGTATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan