ESTScan Details for Unigene SGN-U239687

Score 
354
Direction 
Reverse
Predicted Peptide Sequence 
KGWEVGGYFAIEGTLVVNIGDMLQAWSNDKLRSFEPRVILKKPVNRFSLVFFGGFEDEKVILAPDEVVGEKNSRLSKSFVCSDYLNFRVP
NEKGKFGKVGFPVKDFVGIGSKLK
Predicted Coding Sequence 
AAAGGATGGGAAGTGGGTGGATATTTTGCCATTGAAGGAACTCTTGTGGTAAATATTGGTGACATGCTGCAAGCTTGGAGCAATGACAAA
CTACGATCCTTTGAGCCCCGTGTCATTTTGAAGAAGCCGGTGAACCGCTTTTCTTTAGTTTTCTTTGGGGGCTTTGAGGATGAGAAGGTG
ATTTTGGCCCCTGATGAAGTAGTTGGTGAAAAAAATTCAAGACTTTCCAAGTCATTTGTTTGCTCGGACTATTTAAACTTTAGGGTGCCA
AATGAGAAAGGTAAATTCGGGAAAGTTGGTTTTCCAGTTAAGGATTTTGTTGGGATTGGATCCAAGTTAAAGTAG\
Edits in Original Sequence 
(5')AAAGGATGGGAAGTGGGTGGATATTTTGCCATgTGAAGGAACTCTTGTGGTAAATATTGGTGACATGCTGCAAGCTTGGAGCAATG
ACAAACTACGATCCTTTGAGCCCCGTGTCATTTTGAAGAAGCCGGTGAACCGCTTTTCTTTAGTTTTCTTTGGGGGCTTTGAGGATGAGA
AGGTGATTTTGGCCCCTGATGAAGTAGTTGGTGAAAAAAATTCAAGACTTTCCAAGTCATTTGTTTGCTCGGACTATTTAAACTTTAGGG
TGCCAAATGAGAAAGGTAAATTCGGGAAAGTTGGTTTTCCAGTTAAGGATTTTGTTGGGATTGGATCCAAGTTAAAGTAG\(3')AAGCA
GGGTTGCCATTCTTTGAGTAGTTAGTTTAAAAGCTTGTAAATCCCCCCATGTTCCCCCATTGCAACATAGGTATCTAGGAGTTCTGTTTG
GGGGAAACTTTTTTTTAAAAAAAACTATGTTTTGTTAAAAGAAGAAATTGTTTCCAAGTTACTTGTAAGGCCCTTCAGTGAATGATAAGA
AGATGTTTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan