ESTScan Details for Unigene SGN-U239725

Score 
203
Direction 
Forward
Predicted Peptide Sequence 
REVINLDDDDMPTKVTDTSAAQARKGKDIQGXHMGGIECNQAKLQIDEARTDRNYENIPLSGEAVDKVCEQVEKGGNYYEFFYNAKIRKA
YDTPFSAKKLGWATSKHDVYLISNDSXYALVINFPQPIRSSQLLWTYSTDREICRKFVRGSDTDPNQHNX
Predicted Coding Sequence 
XXGAGAGAGGTTATAAACCTTGATGACGATGATATGCCAACAAAAGTGACTGATACATCAGCTGCACAAGCAAGAAAAGGGAAGGATATA
CAAGGTXATCACATGGGAGGGATTGAATGTAACCAGGCAAAGCTACAGATTGACGAGGCTCGAACAGACAGAAACTATGAGAACATCCCT
TTGTCAGGAGAAGCTGTGGATAAGGTATGCGAACAAGTGGAGAAGGGTGGTAACTACTACGAATTCTTTTACAATGCXAAGATCCGTAAA
GCCTACGATACTCCATTTTCAGCTAAGAAACTTGGTTGGGCAACTTCAAAACATGATGTGTATTTGATTTCAAATGATTCTXCTTATGCA
TTGGTCATCAATTTCCCGCAACCTATCAGAAGTTCTCAACTTCTCTGGACGTATAGTACCGACAGAGAAATATGCAGGAAATTTGTTAGA
GGGTCTGACACTGACCCAAATCAGCACAATGXX\
Edits in Original Sequence 
(5')XXGAGAGAGGTTATAAACCTTGATGACGATGATATGCCAACAAAAGTGACTGATACATCAGCTGCACAAGCAAGAAAAGGGAAGGA
TATACAAGGTXATCACATGGGAGGGATTGAATGTAACCAGGCAAAGCTACAGATTGACGAGGCTCGAACAGtACAGAAACTATGAGAACA
TCCCTTTGTCAGGAGAAGCTGTGGATAAGGTATGCGAACAAGTGGAGAAGGGTGGTAACTACTACGAATTCTTTTACAATGCXAAGATCC
GTAAAGCCTACGATACTCCATTTTCAGCTAAGAAACTTGGTcTGGGCAACTTCAAAACATGATGTGTATTTGATTTCAAATGATTCTXCT
TATGCATTGGTCATCAATTTCCCGCAACCTATCAGAAGTTCTCAACTTCTCTGGACGTATAGTACCGACAGAGAAATATGCAGGAAATTT
GTTAGAGGGTCTGACACTGACCCAAATCAGCACAATGXX\(3')TG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan