Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U239947

Score 
178
Direction 
Forward
Predicted Peptide Sequence 
AVERNLLVKKVDPTEAGDISAVLKAFADYVDSLCGTPYPMNFDIWLTRLKRHIPDDDHGKQIDXLELEIFVFSYGSLAAEYFVALDSLSR
SSGVQEDGSLLLVGHQCRAGVHVGSTNLNSKSTXKLEVLRVNGPWSMRYSLAIQLLHL
Predicted Coding Sequence 
XXTGCAGTGGAGAGAAACCTCTTGGTCAAAAAGGTTGATCCAACAGAAGCTGGAGATATTTCTGCTGTCTTGAAAGCATTCGCAGATTAT
GTTGACAGCCTCTGTGGAACGCCATATCCTATGAATTTTGATATCTGGCTCACAAGGTTAAAGAGACATATTCCTGATGATGATCATGGA
AAACAGATTGATXACCTCGAGTTAGAGATTTTTGTTTTCAGCTATGGAAGCCTTGCAGCAGAATACTTTGTGGCTCTTGACAGTCTTTCA
AGATCTTCAGGAGTACAGGAAGATGGATCCCTTCTATTAGTAGGTCATCAATGCCGGGCAGGAGTTCACGTGGGGTCTACCAACTTGAAC
AGTAAATCAACAXTGAAACTTGAAGTTTTAAGAGTTAATGGTCCCTGGAGCATGCGGTACTCATTAGCTATCCAGCTTTTGCATTTGTGA
\
Edits in Original Sequence 
(5')XXTGCAGTGGAGAGAAACCTCTTGGTCAAAAAGGTTGATCCAACAGAAGCTaGGAGATATTTCTGCTGTCTTGAAAGCATTCGCAG
ATTATGTTGACAGCCTCTGTGGAACGCCATATCCTATGAATTTTGATATCTGGCTCACAAGGTTAAAGAGACATATTCCTGATGATGATC
ATGGAAAACAGATTGATXACCTCGAGTTAGAGATTTTTGTTTTCAGCTATGGAAGCCTTGCAGCAcGAATACTTTGTGGCTCTTGACAGT
CTTTCAAGATCTTCAGGAGTACAGGAAGATGGATCCCTTCTATTAGTAGGTCATCAATGCCGGGCAGGAGTTCACGTaGGGGTCTACCAA
CTTGAACAGTAAATCAACAXTGAAACTTGAAGTTTTAAGAGTTAATGGTCCCTGGAGCATGCGGTACTCATTAGCTATCCAGCTTTTGCA
TTTGTGA\(3')AACAGTTACAGAAGTGTTTCTTTTTCTTTTTTTCTTGTGTCAAATGTGATTATTTGTTGTAAAGACAGGAACTTGTTG
AGATTTCCCTGAGTGAGATATGTGTGATTGTTTACTTTACAGACTTTTAGGAGTAGGACACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan