ESTScan Details for Unigene SGN-U239993

Score 
389
Direction 
Forward
Predicted Peptide Sequence 
GSLDSLRDLDSVFIVGCFNSVKLHTVRLVDXMGSEGPPAVTIHVTGFKKFHGVAENPTETIVSNLKEYVKKRGLPKGVILGSCSILETAG
QGAVVPLYQTLQSAISTAKNESSTPGRVIWVHFGVNSGATKFAIENQAVNEATFRCPDEMGWKPQKVPIIPADGGISRARETSLPVEEIT
KALAKMGYEVMTSDDAGRFVCNYVYYHSLRFAEQNGIKSLFVHVPLFFTIDEETQMQFAASLLEVLASLS
Predicted Coding Sequence 
GGCTCCCTTGATTCCCTCAGGGATCTAGATTCTGTTTTTATCGTTGGATGCTTTAACAGTGTAAAGCTTCATACCGTAAGGCTTGTTGAT
XTGATGGGGTCTGAAGGGCCTCCTGCTGTAACCATCCATGTGACTGGTTTTAAAAAATTTCATGGAGTTGCGGAGAATCCTACTGAGACA
ATTGTCAGTAATCTAAAAGAGTATGTGAAAAAAAGGGGTTTGCCCAAAGGGGTAATCCTTGGCAGTTGCAGTATTCTTGAGACTGCAGGA
CAGGGAGCAGTTGTTCCTTTATATCAGACACTGCAATCTGCTATCAGCACAGCTAAGAACGAGTCATCCACTCCTGGTAGAGTTATTTGG
GTCCATTTCGGAGTTAATAGTGGTGCAACAAAGTTTGCAATAGAGAATCAAGCAGTCAATGAAGCTACATTTCGCTGCCCTGATGAGATG
GGGTGGAAGCCTCAGAAAGTCCCTATTATCCCAGCAGATGGTGGAATTTCAAGAGCACGAGAGACTTCTCTTCCTGTTGAAGAGATCACA
AAGGCATTGGCAAAGATGGGCTATGAAGTGATGACCTCTGATGATGCTGGCCGATTTGTGTGCAACTATGTATACTATCATTCCTTGCGT
TTCGCAGAGCAGAATGGAATCAAATCTCTATTTGTACATGTGCCTCTCTTCTTTACTATAGATGAGGAGACACAAATGCAATTTGCTGCT
TCCTTATTGGAGGTACTTGCCTCTTTATCTTAG\
Edits in Original Sequence 
GGCTTAATAGCTTTGTGTAGATAAGAGTGGTGGTTGAGCCATTTCTTCTTT(5')GGCTCCCTTGATTCCCTCAGGGATCTAGATaTCTG
TTTTTATCGTTGGATGCTTTAACAGTGTAAAGCTTCATACCGTAAGGCTTGTTGATXTGATGGGGTCTGAAGGGCCTCCTGCTGTAACCA
TCCATGTGACTGGTTTTAAAAAATTTCATGGAGTTGCGGAGAATCCTACTGAGACAATTGTCAGTAATCTAAAAGAGTATGTGAAAAAAA
GGGGTTTGCCCAAAGGGGTAATCCTTGGCAGTTGCAGTATTCTTGAGACTGCAGGACAGGGAGCAGTTGTTCCTTTATATCAGACACTGC
AATCTGCTATCAGCACAGCTAAGAACGAGTCATCCACTCCTGGTAGAGTTATTTGGGTCCATTTCGGAGTTAATAGTGGTGCAACAAAGT
TTGCAATAGAGAATCAAGCAGTCAATGAAGCTACATTTCGCTGCCCTGATGAGATGGGGTGGAAGCCTCAGAAAGTCCCTATTATCCCAG
CAGATGGTGGAATTTCAAGAGCACGAGAGACTTCTCTTCCTGTTGAAGAGATCACAAAGGCATTGGCAAAGATGGGCTATGAAGTGATGA
CCTCTGATGATGCTGGCCGATTTGTGTGCAACTATGTATACTATCATTCCTTGCGTTTCGCAGAGCAGAATGGAATCAAATCTCTATTTG
TACATGTGCCTCTCTTCTTTACTATAGATGAGGAGACACAAATGCAATTTGCTGCTTCCTTATTGGAGGTACTTGCCTCTTTATCTTAG\
(3')GACTCTCACATTCTTGTCTCTCTTTTCATCTCGATCTGGTGGCATATTTGCCTCGTCGTGGTCGTCGTGCATGTGACGATGGATGC
AGATATCTCTGTGTCATGCTTCAATAAACTTTTAATTGTGTGTGGAATGGAAATGCGATTTTTGCTGATGAATTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan