ESTScan Details for Unigene SGN-U240316

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
ATAVSRNEKLSAYEELQRYDFPMGILPKGVKDYKLNPKTGEFSAYLNSTCSFKLENSYQLNYKPVIKGVISKGRLRKLCGVSVKVVLLWL
NIVEVNRKGKNLEFSVGLASANFPVENFEECPQCGRGLNCVDEDDNVVSSF
Predicted Coding Sequence 
GCCACTGCAGTTTCAAGAAATGAGAAGCTATCAGCTTATGAAGAGCTACAGCGTTATGATTTCCCAATGGGGATTCTTCCAAAAGGAGTA
AAAGACTACAAATTAAACCCCAAAACAGGTGAATTCTCAGCTTATCTTAATTCTACCTGCAGCTTCAAATTGGAGAACTCATATCAACTG
AATTACAAGCCTGTTATAAAAGGAGTTATATCTAAAGGCAGGCTTAGGAAACTGTGTGGTGTTAGTGTAAAGGTGGTGTTGCTATGGCTT
AACATTGTTGAAGTTAACAGAAAAGGTAAGAATCTTGAGTTTTCAGTTGGACTCGCTTCGGCGAATTTTCCGGTTGAGAATTTTGAGGAA
TGTCCACAGTGTGGACGTGGATTGAATTGTGTTGATGAAGATGACAATGTTGTGTCTTCCTTTTAA\
Edits in Original Sequence 
GCCCTTATAAAAAAAAAACGGTGAACTTTGGAACAACGAAAAACATCAATGTTCACAGAAATGTCAATAGCTTCAACAAGAAGTATTTTT
TACCTCTTTCTCTTCTTTT
(5')GCCACTGCAGTTTCAAGAAATGAGAAGCTATCAGCTTATGAAGAGCTACAGCGTTATGATTTCCCAA
TGGGGATTCTTCCAAAAGGAGTAAAAGACTACAAATTAAACCCCAAAACAGGTGAATTCTCAGCTTATCTTAATTCTACCTGCAGCTTCA
AATTGGAGAACTCATATCAACTGAATTACAAGCCTGTTATAAAAGGAGTTATATCTAAAGGCAGGCTTAGGAAACTGTGTGGTGTTAGTG
TAAAGGTGGTGTTGCTATGGCTTAACATTGTTGAAGTTAACAGAAAAGGTAAGAATCTTGAGTTTTCAGTTGGACTCGCTTCGGCGAATT
TTCCGGTTGAGAATTTTGAGGAATGTCCACAGTGTGGACGTGGATTGAATTGTGTTGATGAAGATGACAATGTTGTGTCTTCCTTTTAA\
(3')AACTACTTTGATTGAAATCTAGTTGTTTTTTTTTTTTTGTTTTCTGGTGGTGGAAATGATGTGTTTTTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan