ESTScan Details for Unigene SGN-U240458

Score 
412
Direction 
Forward
Predicted Peptide Sequence 
MDAKALAKSKRAHSLHLNKKHNPHHASKGSSAVSGTSAGDKKVTVKQVKEKPKPKLPSNWDRYEEENSDSETATPAGASNASDVVEPRSK
GADYAYLLSEAKDQLQFSSEDVSFGDDILDDFYQGLGALLSAXGQSKSSWIAEDNFA
Predicted Coding Sequence 
ATGGATGCAAAAGCGTTGGCAAAGTCGAAGAGAGCTCATTCGTTACATCTTAATAAGAAGCATAATCCACATCATGCATCTAAGGGTTCT
TCTGCTGTTTCTGGCACGTCTGCCGGTGATAAGAAGGTTACTGTCAAGCAAGTTAAGGAAAAGCCTAAACCGAAGCTCCCATCAAATTGG
GATCGATATGAAGAAGAAAATTCAGATTCTGAAACTGCGACCCCAGCAGGCGCAAGTAATGCAAGTGATGTGGTCGAGCCGAGAAGTAAA
GGAGCAGATTATGCATACTTGCTTTCGGAGGCTAAGGATCAGCTTCAGTTTTCTTCAGAGGATGTTTCTTTTGGTGATGATATTTTAGAT
GACTTTTACCAGGGCCTAGGAGCATTACTCTCTGCANAAGGACAAAGCAAGTCATCGTGGATAGCAGAAGACAATTTTGCX\
Edits in Original Sequence 
CTGCCATGTTATTTCGATTTTATTTATCATTAGCATCATTTTGATTTCGAGTTTTATTGCGGTGTGATTAATCAAGAGTTCTGAACAGAG
AAAATGGATGCAAAA
(5')ATGGATGCAAAAGCGTTGGCAAAGTCGAAGAGAGCTCATTCGTTACATCTTAATAAGAAGCATAATCCACA
TCATGCATCTAAGGGTTCTTCTGCTGTTTCTGGCACGTCTGCCGGTGATAAGAAGGTTACTGTCAAGCAAGTTAAGGAAAAGCCTAAACC
GAAGCTCCCATCAAATTGGGATCGATATGAAGAAGAAAATTCAGATTCTGAAACTGCGACCCCAGCAGGCGCAAGTAATGCAAGTGATGT
GGTCGAGCCGAGAAGTAAAGGAGCAGATTATGCATACTTGCTTTCGGAGGCTAAGGATCAGCTTCAGTTTTCTTCAGAGGATGTTTCTTT
TGGTGATGATATTTTAGATGACTTTTACCAGGGCCTAGGAGCATTACTCTCTGCANAAGGACAAAGCAAGTCATCGTGGATAGCAGAAGA
CAATTTTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan