Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U240577

Score 
534
Direction 
Forward
Predicted Peptide Sequence 
LLSXTINFSHNQQSFCFLVKHSYFFAFAVGKKEITNLYKPFLHSSLQLYDNNDTILSSASSAEHYFSVHAILDPIDFLALQAIRKGLDDL
PGSNYFASWDFTSEPCNFAGVYCDGDKVIALNLGDPRAGAPGLTGNLDPSIGKLSALAGVHGGSGSETGPLPESFSQLKKLRFLGVSRNF
LSGDIPASLGLLRELQTLDLSFNQLTGSIPWAIGALPALSNIILCHNHLSX
Predicted Coding Sequence 
XTTCTTCTCTCCTAAACCATTAATTTCAGCCATAACCAACAAAGCTTTTGCTTTCTTGTGAAGCATTCCTACTTTTTTGCCTTTGCTGTT
GGCAAAAAAGAAATAACCAACTTATATAAGCCTTTCCTTCATTCTTCTCTTCAGCTATACGATAATAATGATACCATTCTTTCTTCTGCT
TCTTCTGCAGAGCACTATTTCTCTGTACATGCCATTTTAGACCCAATTGATTTCTTAGCTTTACAAGCGATTCGAAAAGGCTTGGATGAT
TTGCCCGGTTCCAACTATTTTGCTTCCTGGGATTTCACTTCGGAGCCCTGTAACTTCGCCGGAGTTTACTGCGATGGAGATAAAGTGATC
GCCTTGAATCTCGGTGATCCCAGAGCCGGAGCACCAGGGTTAACTGGAAACTTGGATCCTTCTATTGGAAAACTCTCTGCTCTTGCXGGA
GTTCACGGTGGTTCCGGGTCGGAAACTGGTCCATTGCCCGAAAGTTTTTCTCAGTTGAAGAAGCTGAGATTTCTAGGAGTTAGCCGGAAC
TTTCTCTCCGGTGATATTCCGGCGTCATTAGGCCTTCTCCGGGAGCTACAAACTCTTGATCTTAGTTTCAATCAGCTGACCGGGAGCATC
CCTTGGGCTATTGGAGCTCTTCCGGCATTGTCCAACATTATACTGTGTCACAACCACTTGTCCGXX\
Edits in Original Sequence 
(5')XTTCTTCTCTCCTAAACCATTAATTTCAGCCATAACCAACAAAGCTTTTGCTTTCTTGTGAAGCATTCCTACTTTTTTGCCTTTGC
TGTTGGCAAAAAAGAAATAACCAACTTATATAAGCCTTTCCTaTCATTCTTCTCTTCAGCTATACGATAATAATGATACCATTCTTTCTT
CTGCTTCTTCTGCAGAGCACTAgTTTCTCTGTACATGCCATTTTAGACCCAATTGATTTCTTAGCTTTACAAGCGATTCGAAAAGGCTTG
GATGATTTGCCCGGTTCCAACTATTTTGCTTCCTGGGATTTCACTTCGGAGCCCTGTAACTTCGCCGGAGTTTACTGCGATGGAGATAAA
GTGATCGCCTTGAATCTCGGTGATCCCAGAGCCGGAGCACCAGGGTTAACTGGAAACTTGGATCCTTCTATTGGAAAACTCTCTGCTCTT
GCXGGAGTTCACGGTGGTTCCGGGTCGGAtAACTGGTCCATTGCCCGAAAGTTTTTCTCAGTTGAAGAAGCTGAGATTTCTAGGAGTTAG
CCGGAACTTTCTCTCCGGTGATATTCCGGCGTCATTAGGCCTTCTCCGGGAGCTACAAACTCTTGATCTTAGTTTCAATCAGCTGACCGG
GAGCATCCCTTGGGCTATTGGAGCTCTTCCGGCATTGTCCAACATTATACTGTGTCACAACCACTTGTCCGXX\(3')CG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan