ESTScan Details for Unigene SGN-U240695

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
LTEAVSPQTPVSFWIISSFMIVAAVAAASPPVSXAIFELKSRLFPRSKAASLQVTEMQKLQHAAPIHAHIIKNGNPNDPFILFELLVFVL
DAAPLNMLPRFSGKSPDPNVFIYTAFIEVLVSSGAYSDGIRTYFQMIKDFILPDIYIIPLVLKACGVWIRFKERSANPLPGYEIGIEFGQ
VREGKVNGTLWKMWRFNDAKKVFDEMPQRDVVALTGYDIVVLDHGL
Predicted Coding Sequence 
TTGACAGAAGCTGTTTCCCCTCAAACACCCGTCTCGTTTTGGATAATTAGTTCCTTCATGATAGTCGCCGCCGTCGCCGCGGCGTCGCCA
CCTGTTTCCXCCGCCATATTTGAACTCAAATCCCGGCTGTTTCCGAGATCGAAAGCAGCTTCTCTTCAAGTTACAGAAATGCAAAAGCTT
CAACATGCTGCTCCAATTCATGCGCATATAATAAAAAACGGCAATCCCAATGACCCCTTTATTCTATTCGAGCTTCTTGTATTTGTTCTA
GATGCTGCTCCATTGAATATGCTTCCAAGATTTTCCGGCAAATCCCCXGACCCTAATGTATTTATCTATACTGCTTTTATTGAAGTGCTT
GTGTCTTCAGGGGCTTACTCTGATGGAATTAGAACTTATTTTCAAATGATTAAGGATTTTATTTTACCTGATATTTATATAATCCCTTTG
GTTCTTAAGGCATGTGGXGTGTGGATTAGATTTAAAGAGCGGTCAGCAAATCCATTGCCAGGTTATGAAATTGGGATTGAGTTTGGACAG
GTTCGTGAGGGTAAAGTTAATGGAACTTTATGGAAAATGTGGAGGTTTAATGATGCAAAGAAGGTGTTTGATGAAATGCCTCAAAGAGAT
GTTGTTGCCCTCACXGGTTATGATATCGTNGTTCTTGATCATGGACTX\
Edits in Original Sequence 
(5')TTGACAGAAGCTGTTTCCCCTCAAACACCCGTCTCGTTTTGGATAATTAGTTCCTTCATGATAGTCGCCGCCGTCGCCGCGGCGTC
GCCACCTGTTTCCXCCGCCATATTTGAACTCAAATCCCGGCTGTTTCCGAGATCGAAAGCAGCTTCTCTTCAAGTTACAGAAATGCAAAA
GCaTTCAACATGCTGCTCCAATTCATGCGCATATAATAAAAAACGGCAATCCCAATGACCCCTTTATTCTATTCGAGCTTCTTcGTATTT
GTTCTAGATGCTGCTCCATTGAATATGCTTCCAAGATTTTCCGGCAAATCCCCXGACCCTAATGTATTTATCTATACTGCTTTTATTGAA
GTGCTTGTGTCTTCAGGGGCTTACTCTGATGGAATTAGAACTTATTTTCAAATGATTAAGGATTTTATTTTACCTGATATTTATATAATC
CCTTTGGTTCTTAAGGCATGTGGXGTGTGGATTAGATTTAAAGAGCGGTCAGCAAATCCATTGCCAGGTTATGAAATTGGGATTGAGTTT
GGACAGGTTCGTGAGGGTAAAGTTAATGGAACTTTATGGAAAATGTGGAGaGTTTAATGATGCAAAGAAGGTGTTTGATGAAATGCCTCA
AAGAGATGTTGTTGCCCTCACXGGTTATGATATCGTNGTaTCTTGATCATGGACTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan