ESTScan Details for Unigene SGN-U240700

Score 
514
Direction 
Forward
Predicted Peptide Sequence 
KGCEILRVCEEMIGKLGLISLNETKDDISTANLKYILVPYYLAELTEKIAEDDRIEVLKASQAKLKEFISFCETMELVPEDEIETSTQGG
SSSSVDRRAKKIARFKRQRAAESKLLELKERRERRGRSTKAAALSSPVETGEEDVFDDDGEEEREAWLTTISLALCKAFDLLEMLKKEEE
ILS
Predicted Coding Sequence 
AAAGGTTGTGAGATTTTGAGAGTGTGTGAAGAAATGATTGGGAAATTAGGGCTGATTTCGCTTAATGAGACTAAAGATGATATTAGCACA
GCAAATCTCAAGTATATTCTGGTCCCTTATTATCTAGCGGAGCTAACAGAAAAAATTGCAGAAGATGACAGGATAGAAGTACTCAAGGCT
TCACAAGCTAAGCTAAAGGAGTTCATTTCATTTTGTGAGACAATGGAACTTGTTCCTGAAGACGAGATAGAGACATCTACCCAAGGTGGA
TCTAGTTCTTCTGTAGATCGTAGAGCTAAAAAGATAGCTCGTTTCAAACGTCAAAGAGCTGCTGAGTCAAAACTACTTGAATTGAAGGAG
CGGAGAGAGCGTCGTGGACGATCGACTAAAGCAGCTGCATTGTCAAGTCCTGTGGAAACTGGAGAAGAGGACGTGTTTGATGATGACGGT
GAAGAAGAAAGGGAGGCATGGCTTACAACTATTTCCCTGGCCCTTTGTAAGGCCTTTGATTTGCTTGAAATGCTGAAGAAAGAGGAAGAA
ATACTATCX\
Edits in Original Sequence 
(5')AAAGGTTGTGAGATTTTGAGAGTGTGTGAAGAAATGATTGGGAAATTAGGGCTGATTTCGCTTAATGAGACTAAAGATGATATTAG
CACAGCAAATCTCAAGTATATTCTGGTCCCTTATTATCTAGCGGAGCTAACAGAAAAAATTGCAGAAGATGACAGGATAGAAGTACTCAA
GGCTTCACAAGCTAAGCTAAAGGAGTTCATTTCATTTTGTGAGACAATGGAACTTGTTCCTGAAGACGAGATAGAGACATCTACCCAAGG
TGGATCTAGTTCTTCTGTAGATCGTAGAGCTAAAAAGATAGCTCGTTTCAAACGTCAAAGAGCTGCTGAGTCAAAACTACTTGAATTGAA
GGAGCGGAGAGAGCGTCGTGGACGATCGACTAAAGCAGCTGCATTGTCAAGTCCTGTGGAAACTGGAGAAGAGGACGTGTTTGATGATGA
CGGTGAAGAAGAAAGGGAGGCATGGCTTACAACTATTTCCCTGGCCCTTTGTAAGGCCTTTGATTTGCTTGAAATGCTGAAGAAAGAGGA
AGAAATACTATCX\(3')TCTGCTGTCAGGGAGAAGCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan