ESTScan Details for Unigene SGN-U240755

Score 
105
Direction 
Forward
Predicted Peptide Sequence 
PRSTDPDISADSEFEDDFEVRKSKLDTSAIEARNGKDIQGIPWERLNFTRDKYRETRLKQYKNYESLSRSREDLEKEXQGSRKRTQLLRL
PVQYKARQINYRALSGNIDFXSLFLFGFMLTFDQENRGLVCLPEFFVIDLVSVXLILHYSIKPGKRLPWLPFSF
Predicted Coding Sequence 
CCGCGAAGTACTGACCCGGATATCTCTGCAGACTCGGAATTTGAGGACGATTTTGAAGTGAGAAAGTCAAAGCTGGATACATCAGCTATA
GAAGCTAGAAATGGCAAGGATATACAGGGAATACCTTGGGAAAGGCTTAATTTTACCAGAGACAAGTACCGCGAGACGAGGTTGAAGCAG
TATAAGAACTACGAGAGCCTGTCTCGCTCTCGTGAAGATCTTGAAAAGGAGXTGCAAGGAAGTAGGAAAAGGACACAGCTTCTACGACTT
CCAGTTCAATACAAGGCTCGTCAAATCAACTATCGTGCACTTTCAGGTAATATAGATTTTXTTAGCCTTTTCTTGTTTGGATTTATGTTA
ACCTTTGATCAAGAAAATCGTGGACTGGTCTGCCTCCCTGAGTTCTTTGTGATTGATTTAGTCTCTGTTGXTCTCATTTTGCATTATTCA
ATTAAACCTGGCAAACGACTCCCATGGCTGCCTTTCTCATTC\
Edits in Original Sequence 
(5')CCGCGAAGTACTGACCCGGATATCTCTGCAGACTCGGAATTTGAGGACGATTTTGAAGTGAGAAAGTCAAAGCTGGATACATCAGC
TATAGAAGCTAGAAATGGCAAGGATATACAGGGAATACCTTGGGAAAGGCTTAATTTTACCAGAGACAAGTACCGCGAGACGAGGTTGAA
GCAGTATAAGAACTACGAGAGCCTGTCTCGCTCTCGTGAAGATCTTGAAAAGGAGXTGCAAGGAAGTAGGAAAAGGACACAGCTTCTACG
ACTTCCAGTTCAATACAAGGCTCGTCAAATCAACTATCGTGCACTTTCAGGTAATATAGATTTTXTTAGCCTTTTCTTGTTTGGATTTAT
GTTAACCTTTGATCAAGAAAATCGTGGACTGGTCTGCCTCCCTGtAGTTCTTTGTGATTGATTTAGTCTCTGTTGXTCTCATTTTGCATT
ATTCAATTAAACCTGGCAAACGACTCCCATGGCTGCCTTTCTCATTC\(3')TC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan