ESTScan Details for Unigene SGN-U240829

Score 
289
Direction 
Forward
Predicted Peptide Sequence 
MDLRDVGATLPPGFKFCPTDEELICHYLYNKIANEKGLVLNFSLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYSTGFRANRATTS
GYWKATGKDRIVLDPQTSNVIGMRKTLVFYKNRAPNGIKTDWIMHEFRLEIPHIPL
Predicted Coding Sequence 
ATGGATTTAAGAGATGTTGGAGCTACACTTCCCCCTGGGTTTAAATTTTGCCCCACTGATGAAGAGTTAATTTGTCATTATCTCTATAAT
AAAATTGCTAATGAAAAAGGATTGGTTCTTAATTTTAGTTTAGTGGAAATTGATCTTCACACTTGTGAGCCATGGCAGCTTCCTGAGGTG
GCAAAGCTCAACTCTAGTGAATGGTACTTCTTCAGCTTCCGAGATCGAAAGTATTCTACTGGCTTTCGGGCGAACCGGGCCACAACTTCG
GGTTATTGGAAAGCTACGGGTAAAGATCGAATCGTGCTTGATCCTCAAACCAGTAATGTTATTGGGATGAGAAAAACTTTAGTCTTTTAC
AAGAATAGAGCTCCTAATGGCATTAAAACAGACTGGATCATGCATGAATTTCGACTTGAAATTCCCCATATACCCCTX\
Edits in Original Sequence 
CAACACTCCTTCTCTGTTTATAAATAATCTCATTTGTCCCTTTGAAATTGATAATTTATCAAACATGAATTGAATACTATTTATATTCTC
CTCTCATTTTTTCTCCAAACTCACAAAAAGATAAATTGTTGAACATATTTTCAACTCTTTTCTTTTATTATTATTTATTATCAAAAAATT
AAAAA
(5')ATGGATTTAAGAGATGTTGGAGCTACACTTCCCCCTGGGTTTAAATTTTGCCCCACTGATGAAGAGTTAATTTGTCATTAT
CTCTATAATAAAATTGCTAATGAAAAAGGATTGGTTCTTAATTTTAGTTTAGTGGAAATTGATCTTCACACTTGTGAGCCATGGCAGCTT
CCTGAGGTGGCAAAGCTCAACTCTAGTGAATGGTACTTCTTCAGCTTCCGAGATCGAAAGTATTCTACTGGCTTTCGGGCGAACCGGGCC
ACAACTTCGGGTTATTGGAAAGCTACGGGTAAAGATCGAATCGTGCTTGATCCTCAAACCAGTAATGTTATTGGGATGAGAAAAACTTTA
GTCTTTTACAAGAATAGAGCTCCTAATGGCATTAAAACAGACTGGATCATGCATGAATTTCGACTTGAAATTCCCCATATACCCCTX\(3')
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan