ESTScan Details for Unigene SGN-U240844

Score 
116
Direction 
Reverse
Predicted Peptide Sequence 
AGKNEGLRLFVIVRDFLIILDKVCIEVKNAQRKLNGTPKKENVASKTSESSNPPSLDLRQKLFPAITDRRIDDSSSDDDAFKIRDLSHFR
AQDGKXGKRDSVFEVVLTEGSQFEAAEVVGVAQRRRYG
Predicted Coding Sequence 
XXTGCAGGGAAAAATGAAGGTTTACGATTATTTGTTATCGTTCGTGATTTTCTGATAATATTAGATAAGGTATGCATAGAGGTGAAAAAT
GCTCAGAGAAAGCTAAACGGCACACCAAAGAAGGAGAATGTAGCAAGTAAAACTTCAGAGTCCAGCAATCCACCGTCCCTCGATCTCCGC
CAGAAGCTCTTTCCGGCTATCACAGATAGGAGAATTGACGATTCTAGTTCGGACGATGATGCTTTTAAGATAAGGGATCTGAGTCATTTT
CGAGCTCAAGATGGTAAAXTAGGGAAACGAGATTCAGTTTTTGAAGTTGTGCTAACCGAGGGATCTCAATTCGAGGCAGCAGAGGTGGTT
GGAGTTGCTCAAAGACGACGATATGGCTAG\
Edits in Original Sequence 
(5')XXTGCAGGGAAAAATGAAGGTTTACGATTATTTGTTATCGTTCGTGATTTTCTGATAATATTAGATAAGGTATGCATAGAGGTGAA
AAATGCTCAGAGAAAGCTAAACGGCACACCAAAGAAGGAGAATGTAGCAAGTAAAACTTCAGAGTCCAGCAATCCACCGTCCCTCGATCT
CCGCCAGAAGCTCTTTCCGGCTATCACAGATAGGAGAATTGACGATTCTAGTTCGGACGATGATGCTTcTTAAGATAAGGGATCTGAGTC
ATTTTCGAGCTCAAGtATGGTAAAXTAGGGAAACGAGATTCAGTTTTTGAAcGTTGTGCTAACCGAGGGATCTCAATTCGAGGCAGCAGA
GGTGGTTGGAGTTGCTCAAAGACGACGATATGGCTAG\(3')TACATGGCTCTATTTCAATTATTTTCTTCACTGAATTTCCATTTGTAC
TTTAGAAGAATAGTTAGGAAAAATTCTCATTCATTTTTTTTTTTATAGTTTAGTTGATAATTCTTTTTTTTTAATTAAATGTACTTGAAT
AAAGTAGTTATATTAATTATTATATATGGTGTTCACAAATTGAAATGGTCAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan