ESTScan Details for Unigene SGN-U240953

Score 
318
Direction 
Forward
Predicted Peptide Sequence 
YIWRKLNEKHNYPPEGGGSEGXEVNGKKEDGEENRVEKNNGNEIKSLLALKSIFSFNGKKRNGDSEGGNDAPAYNPLPFLSSLANSVVSR
SCKILQVEIEELQHQFDSDLVDDVKQPLVYARNFLEFCSFQALQVVTIRPDYLSDKEFRRLMFDMMLAWEVPGVGNQETTASDKREVEDE
DSWSLFYSX
Predicted Coding Sequence 
XXTTACATTTGGCGTAAATTGAATGAAAAGCATAATTATCCGCCGGAAGGCGGTGGATCTGAAGGTGAXGAAGTAAACGGGAAGAAGGAA
GATGGAGAAGAGAATAGAGTGGAGAAGAATAATGGCAACGAGATAAAGAGTTTGCTAGCGTTGAAATCCATATTCTCTTTCAACGGAAAA
AAGCGAAACGGTGACAGTGAAGGTGGCAATGATGCACCGGCTTACAACCCTTTACCTTTTCTATCTTCACTCGCTAATTCTGTTGTCTCT
CGTTCTTGCAAGATTTTGCAGGTAGAGATTGAAGAGTTGCAACATCAATTTGATTCAGATCTTGTTGATGATGTTAAACAACCCTTAGTG
TATGCAAGGAACTTTCTGGAATTTTGCTCCTTCCAAGCTCTTCAAGTTGTAACCATCCGTCCTGATTATCTGAGCGATAAGGAATTCCGT
CGGTTGATGTTCGACATGATGCTAGCATGGGAGGTCCCTGGTGTTGGAAATCAAGAAACTACAGCCTCCGATAAGAGGGAAGTGGAGGAT
GAAGATAGCTGGTCATTGTTTTATTCGGAX\
Edits in Original Sequence 
(5')XXTTACATTTGGCGTAAATTGAAtTGAAAAGCATAATTATCCGCCGGAAGGCGGTGGATCTGAAGGTGAXGAAGTAAACGGGAAGA
AGGAAGATGGAGAAcGAGAATAGAGTGGAGAAGAATAATGGCAACGAGATAAAGAGTTTGCTAGCGTTGAAATCCATATTCTCTTTCAAC
GGAAAAAAGCGAAACGGTGACAGTGAAGGTGGCAATGATGCACCGGCTTACAACCCTTTACCTTTTCTATCTTCACTCGCTAATTCTGTT
GTCTCTCGTTCTTGCAAGATTTTGCAGGTAGAGATTGAAGAGTTGCAACATCAATTTGATTCAGATCTTGTTGATGATGTTAAACAACCC
TTAGTGTATGCAAGGAACTTTCTGGAATTTTGCTCCTTCCAAGCTCTTCAAGTTGTAACCATCCGTCCTGATTATCTGAGCGATAAGGAA
TTCCGTCGGTTGATGTTCGACATGATGCTAGCATGGGAGGTCCCTGGTGTTGGAAATCAAGAAACTACAGCCTCCGATAAGAGGGAAGTG
GAGGATGAAGATAGCTGGTCATTGTTTTATTCGGAX\(3')TTATTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan