ESTScan Details for Unigene SGN-U241015

Score 
65
Direction 
Reverse
Predicted Peptide Sequence 
NEADRVILDELARRLVLTGAQXEEHINGGKGSPHLKVLTMVELAGIFGWENQAGPMCSAKRPEVGPSLRFQNMRLRKGDAELPGLFRVIT
SKLLEVPFVCEGGSEMAAALRNGDKPRDKRSYVSASRDIDDKP
Predicted Coding Sequence 
AATGAGGCAGACCGGGTGATACTGGATGAACTTGCTAGGAGGTTGGTCTTAACCGGTGCTCAGGXTGAAGAGCACATTAACGGCGGTAAA
GGATCTCCACATCTGAAAGTTCTTACAATGGTTGAACTCGCTGGAATATTCGGTTGGGAAAATCAAGCAGGCCCAATGTGCTCCGCCAAG
AGGCCXGAGGTGGGACCAAGTTTGAGGTTTCAAAACATGAGGCTCAGAAAAGGGGACGCTGAGCTTCCTGGCCTTTTTCGGGTGATCACA
TCCAAGCTCTTGGAAGTGCCCTTTGTGTGTGAGGGCGGTTCTGAGATGGCAGCXGCTTTGCGTAATGGGGATAAACCTCGAGACAAGAGA
AGCTATGTTTCXGCTAGTAGAGATATTGATGACAAGCCTTAA\
Edits in Original Sequence 
(5')AATGAGGCAGACCGGGTGATACTGGATGAACTTGCTAGGAGGTTGGTCTTAACCGGTGCTCAGGXTGAAGAcGCACATTAACGGCG
GTAAAGGATCTCCACATCTGAAAGTTCTTACAATGGTTGAACTCGCTGGAATATTCGGTTGcGGAAAATCAAGCAGGCCCAATGTGCTCC
GCCAAGAGGCCXGAGGTGGGACCAAGTTTGAGGTTTCAAAACATGAGGCTCAGAAAAGGGGACGCTGAGCTTCCTGGCCTTTTTCGGGTG
ATCACATCCAAGCTCTTGGAAGTGCCCTTTGTGTGTGAGGGCGGTTCTGAGATGGCAGCXGCTTTGCGTAATGGGGATAAACCTCGAGAC
AAGAGAAGCTATGTTTCXGCTAGTAGAGATATTGATGACAAGCCTTAA\(3')TAGATGAATTCTTACTTATGTAGAGTATCTCTTAGTA
TCTGTAGTACTTCGTCTAGTATTACTTCGTTTGAAAATGTCATTTTTAACGAGAAGAAGAAAGGTTGAGAAGACCACAGCTTCATCATAC
ATGAGTTGGGTTTTACTTTTCTTTCTTTCCCGCCTCCAAAGGACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan