ESTScan Details for Unigene SGN-U241089

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
VRAMAGESVTGAIGKIENGLDLDAEIISGLVSYCELXPPLDAKEYLDNIIGQDAGKSVTGEYLRRRGHSDLYQGTSASKLQAYVKPPSGD
SLATGTKKQVR
Predicted Coding Sequence 
GTCAGGGCAATGGCTGGAGAAAGCGTTACTGGAGCTATTGGCAAGATTGAGAACGGTCTTGATTTAGATGCTGAGATTATTTCTGGGCTT
GTTTCTTATTGTGAGCTTGNACCTCCTCTAGACGCTAAAGAATATCTTGATAATATCATAGGTCAGGATGCTGGAAAAAGTGTGACGGGT
GAGTATTTGAGACGGAGAGGTCATTCAGATTTATACCAAGGTACTTCTGCTTCCAAATTGCAAGCATATGTAAAGCCTCCTTCAGGTGAT
AGTCTGGCAACTGGAACGAAAAAACAAGTACGX\
Edits in Original Sequence 
(5')GTCAGGGCAATGGCTGGAGAAAGCGTTACTGGAGCTATgTGGCAAGATTGAGAACGGTCTTGATTTAGATGCTGAGATTATTTCTG
GGCTTGTTTCTTATTGTGAGCTTGNACCTCCTCTAGACGCTAAAGAATATCTTGATAATATCATAGGTCAGGATGCTGGAAAAAGTGTGA
CGGGTGAGTATTTGAGACGGAGAGGTCATTCAGATTTATACCAAGGTACTTCTGCTTCCAAATTGCAAGCATATGTAAAGCCTCCTTCAG
GTGATAGTCTGGCAACTGGAACGAAAAAACAAGTACGX\(3')GCGCACCAAAAGAAAGTAAAGCCTCAAGTAAGCAGGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan