ESTScan Details for Unigene SGN-U241396

Score 
527
Direction 
Forward
Predicted Peptide Sequence 
SCLLLLSSTATGDDDISRAAPANASSSCNNPYRMVLVKLWIDGAEQESIGGLSAAFGSLLSTDTKNAPRLPATCTKPLNGCSSSSFKLSG
SIALALRGQCDFLTKAMVAQAGGAAGIVLINDQEDLVEMACPNNSTVSNVTIPVVTISKAGGDVIDKYISAGKKVEIMFYSPDRPIVDYS
AMFIWMMAVGX
Predicted Coding Sequence 
AGTTGTCTTCTTCTGTTATCATCAACCGCAACCGGTGATGATGATATCTCACGCGCCGCCCCTGCTAATGCATCGAGCTCCTGTAACAAT
CCTTATCGAATGGTTCTGGTGAAATTATGGATTGATGGTGCTGAGCAAGAATCAATAGGTGGCTTAAGTGCGGCATTTGGATCTCTTTTA
TCCACTGATACTAAAAATGCCCCTAGATTGCCTGCTACTTGTACAAAACCCTTGAATGGCTGTTCCAGCTCCTCTTTTAAGTTATCAGGC
TCCATTGCACTAGCTCTTCGCGGTCAATGTGATTTTCTAACGAAGGCTATGGTTGCACAAGCAGGAGGTGCTGCAGGGATTGTGCTGATA
AATGATCAAGAAGATCTTGTGGAGATGGCTTGTCCTAACAATTCTACAGTATCAAACGTAACAATTCCTGTTGTAACCATTTCAAAAGCC
GGAGGAGATGTCATAGACAAGTATATCTCTGCTGGAAAGAAAGTGGAGATTATGTTTTATTCGCCAGATCGGCCCATTGTGGACTACTCA
GCAATGTTCATATGGATGATGGCTGTTGGCAXX\
Edits in Original Sequence 
(5')AGTTGTCTTCTTCTGTTATCATCAACCGCAACCGGTGATGATGATATCTCACGCGCCGCCCCTGCTAATGCATCGAGCTCCTGTAA
CAATCCTTATCGAATGGTTCTGGTGAAATTATGGATTGATGGTGCTGAGCAAGAATCAATAGGTGGCTTAAGTGCGGCATTTGGATCTCT
TTTATCCACTGATACTAAAAATGCCCCTAGATTGCCTGCTACTTGTACAAAACCCTTGAATGGCTGTTCCAGCTCCTCTTTTAAGTTATC
AGGCTCCATTGCACTAGCTCTTCGCGGTCAATGTGATTTTCTAACGAAGGCTATGGTTGCACAAGCAGGAGGTGCTGCAGGGATTGTGCT
GATAAATGATCAAGAAGATCTTGTGGAGATGGCTTGTCCTAACAATTCTACAGTATCAAACGTAACAATTCCTGTTGTAACCATTTCAAA
AGCCGGAGGAGATGTCATAGACAAGTATATCTCTGCTGGAAAGAAAGTGGAGATTATGTTTTATTCGCCAGATCGGCCCATTGTGGACTA
CTCAGCAATGTTCATATGGATGATGGCTGTTGGCAXX\(3')CA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan