Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U241454

Score 
253
Direction 
Forward
Predicted Peptide Sequence 
KIYHQMDDLGTPRSAISFNXAFISLRGSKLYDRVPQLFDEIPVKYRFLPDKVSYGILIRSYCETGLPEMAMEILKVMEEKSVEITTVTFT
TILHSFYKKGKSDEAEKVWNEMVNRGCGPDVGAYNVKIMNIQGGDLEGVKALIEEMNDAGLKPDTISYNYLMTCYCKNELMDEAQMVYDD
LX
Predicted Coding Sequence 
XTCAAAATTTATCATCAGATGGATGATTTAGGCACCCCCAGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGGCTCAAAA
CTATATGATCGTGTCCCCCAGCTGTTTGATGAAATTCCAGTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGATTAGG
TCATATTGTGAAACGGGGTTGCCGGAAATGGCAATGGAAATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTACTTTC
ACTACTATACTACATTCATTCTACAAGAAAGGGAAGAGTGATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTGGTCCA
GATGTTGGTGCATACAATGTGAAGATTATGAACATTCAGGGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACGATGCT
GGATTGAAACCTGATACGATTAGCTACAATTATTTGATGACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTTATGAT
GATCTGGXX\
Edits in Original Sequence 
(5')XTCAAAATTTATCATCAGATGGATGATTTAGGCACCCCCAGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGcGCT
CAAAACTATATGATCGTGTCCCCCAGCTGTTTGATGAAATTCCAGTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGA
TTAGGTCATATTGTGAAACGGGGTTGCCGGAAATGGCAATGGAAATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTA
CTTTCACTACTATACTACATTCATTCTACAAGAAAGGGAAGAGTGATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTG
GTCCAGATGTTGGTGCATACAATGTGAAGATTATGAACATTCAGGGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACG
ATGCTGGATTGAAACCTGATACGATTAGCTACAATTATTTGATGACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTT
ATGATGATCTGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan