ESTScan Details for Unigene SGN-U241540

Score 
360
Direction 
Reverse
Predicted Peptide Sequence 
ICKETHGYVGADLAALCTEAALQCIREKMDVIDLEDESIDAEILNPMAVTNEHFSTALGTSNPSALRETVSLHFFSFKASPTTYPPLFPN
YDXMAEQVVEVPNISWEDIGGLENVKRELQEVHIY
Predicted Coding Sequence 
XGGATTTGCAAAGAAACACATGGTTATGTTGGTGCGGATTTGGCAGCTTTGTGTACTGAGGCTGCACTTCAGTGCATCAGAGAGAAGATG
GATGTGATTGATTTGGAAGATGAATCTATCGACGCAGAGATATTAAATCCAATGGCTGTGACCAACGAGCACTTCTCAACTGCTCTTGGG
ACAAGCAATCCATCTGCCCTGCGTGAAACTGTAAGTCTACATTTCTTTTCGTTCAAGGCTTCTCCTACTACATATCCTCCACTCTTTCCT
AATTATGACGXTATGGCGGAACAGGTTGTTGAAGTTCCTAATATCTCCTGGGAGGACATTGGAGGCCTTGAGAATGTCAAGCGTGAGCTT
CAAGAGGTACATATATACTAA\
Edits in Original Sequence 
(5')XGGATTTGCAAAGAAACACATGGTTATGTTGGTGCGGATTTGGCAGCTTTGTGTACTGAGGCTGCACTTCAGTGCATCAGAGAGAA
GATGGATGTGATTGATTTGGAAGATGAATCTATCGACGCAGAGATATTAAATCCAATGGCTGTGACCAACGAGCACTTCTCAACTGCTCT
TGGGACAAGCAATCCATCTGCCCTGCGTGAAACTGTAAGTCTACATTTCTTTTCGTTCAAGGCTTCTCCTACTACATATCCTCCACTCgT
TTCCTAATTATGACGXTATGGCGGAACAGGTTGTTGAAGTTCCTAATATCTCCTGGGAGGACATTGGAGGCCTTGAGAATGTCAAGCGTG
AGCTTCAAGAGGTACATATATACTAA\(3')CAAGCGTGAGCTTCAAGAGGTACATATATACTAAACATAAAATGATGAATATTATGATC
TGCTAACCTGTTAACCTTGTTGATTTACCTGACCTAATCTTTTATTTGTTTTGTAGACTGTTCAATATCCTGTGGAACATCCCGAGAAGT
TCGAGAAGTTTGGTATGTCTCCTTCTAAGGGTGTTCTCTTCTATGGGCCACCATGTGGTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan