ESTScan Details for Unigene SGN-U241661

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
NSRKIVLRHQDVQEKKDVQGLLNNVIEETASKLVETRKSKVKALVGAFETVISLQDKPSTVTXFLINNHKFQHIGAIANIVDDITFLTWF
KYVCRVSHSDSSS
Predicted Coding Sequence 
XCTAACTCCAGAAAAATTGTTTTGAGGCATCAGGATGTGCAGGAAAAGAAAGATGTGCAGGGTTTGTTGAATAATGTGATTGAAGAGACG
GCGAGTAAGCTTGTTGAAACCAGGAAAAGCAAGGTTAAAGCTTTGGTGGGAGCTTTTGAGACAGTTATTTCCCTCCAAGATAAACCTTCT
ACAGTAACAGXTTTCTTGATTAACAACCATAAATTTCAACACATAGGAGCAATTGCAAATATAGTGGATGATATAACTTTTCTGACCTGG
TTTAAGTATGTTTGTCGTGTTTCTCATTCTGACTCATCGTCTTAA\
Edits in Original Sequence 
(5')XCTAACTCCAGAAAAATTGTTTTGAGGCATCAGGATGTGCAGGAAAAGAAAGATGTGCAGGGTTTGTTGAATAATGTGATTGAAGA
GACGGCGAGTAAGCTTGTTGAAACCAGGAAAAGCAAGGTTAAAGCTTTGGTGGGAGCTTTTGAGACAGTTATTTCCCTCCAAGATAAACC
TTCTACAGTAACAGXTTTCTTGATTAACAACCATAAATTTCtAACACATAGGAGCAATTGCAAATATAGTGGATGATATAACTTTTCTGA
CCTGGTTTAAGTATGTTTGTCGTGTTTCTCATTCTGACTCATCGTCTTAA\(3')AACGATTTCTTGATGGCTTTCTGGTTCTGTTCTCT
TGATTGAATAAATTCAGTTTCATCTGGATGCACCTACTTGGAATTGAGAGATTAAGTCGCGTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan