ESTScan Details for Unigene SGN-U241696

Score 
250
Direction 
Forward
Predicted Peptide Sequence 
VFFPFNVSSCSIDAYHHLLEMLFENHQFLLEYXDFSQRQQWYFTVLKVLTDYDIFIDPXKRKHDGEEEFNDVHKHKRSKHKSSKIDDIGA
IKVAS
Predicted Coding Sequence 
XXAGTTTTTTTCCCTTTCAATGTAAGTTCTTGTTCAATTGATGCTTATCATCATCTACTTGAGATGCTTTTTGAAAATCACCAATTTTTG
CTGGAGTATAXGGACTTCAGCCAGAGGCAACAATGGTACTTCACAGTACTGAAAGTGTTGACTGATTATGATATTTTCATTGATCCCAXG
AAAAGGAAGCATGATGGAGAGGAGGAATTTAATGATGTTCACAAACACAAGAGAAGCAAGCACAAGAGCTCAAAGATTGATGATATTGGT
GCAATAAAGGTAGCAAGCTGA\
Edits in Original Sequence 
(5')XXAGTTTTTTTCCCTTTCAATGTAAGTTCTTGTTCAATTGATGCTTATCtATCATCTACTTGAGATGCTTTTTGAAAATCACCAAT
TTTTGCTGGAGTATAXGGACTTCAGCCAGAGGCAACAATGGTACTTCACAGTACTGAAAGTGTTGACTGATTATGATATTTTCATTGATC
CCAXGAAAAGGAAGCATGATGGAGAGGAGGAATTTAATGATGTTCACAAACACAAGAGAAGCAAGCACAAGAGCTCAAAGATTGATGATA
TTGGTGCAATAAAGGTAGCAAGCTGA\(3')GAAATATGTGTGTGGTTATATCATTTGTTTTATCCTCAGACTTTGCAATTGAGAATTTG
GAGGGATCCTTTACTTAGTATTGTGGAAAATCAGAGGTACAGAAGTTAATTCATGCTATATCCCATTAATTGAATGCTATATCCCATTAA
TTGAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan