Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U241824

Score 
461
Direction 
Forward
Predicted Peptide Sequence 
MTYLLDSPNVLPVGDGACWENLYANFIPPSNTFPTDYVPTVFDNLQCKCGGGGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLI
SKASYENIYKKWIPELRHYAPTIQIVLVGTKLDLREDKQYLSDHPGATPISTAQGEELKKMIGAVAYIECSSKTQQNVKAVFDTAIXVAL
RPXLDEEKAPXKGGRYVQFYEY
Predicted Coding Sequence 
ATGACCTACCTGCTAGACTCACCAAATGTGTTACCTGTTGGTGATGGAGCCTGTTGGGAAAACTTGTATGCTAATTTCATACCACCTAGT
AATACTTTTCCAACGGATTATGTTCCAACGGTGTTCGATAACCTTCAGTGCAAATGTGGTGGTGGTGGTAGCACTGTTAACCTTGGCCTA
TGGGATACTGCAGGACAAGAAGACTATAACAGGCTAAGGCCATTAAGTTACAGAGGAGCTGATGTCTTTTTGCTTGCTTTTTCTCTAATT
AGCAAAGCAAGCTATGAGAACATCTACAAAAAGTGGATCCCTGAGTTAAGGCACTATGCTCCTACTATACAAATTGTTCTGGTGGGAACT
AAACTTGACCTGAGGGAAGACAAACAATATTTAAGTGATCATCCAGGGGCTACTCCTATATCAACTGCCCAGGGAGAGGAATTGAAAAAG
ATGATAGGAGCGGTTGCCTACATTGAGTGTAGCTCCAAGACTCAGCAGAATGTGAAAGCTGTATTTGATACTGCNATTAANGTAGCATTG
CGACCCXCCCTAGATGAAGAAAAGGCCCCAAAXAAAGGAGGACGTTATGTGCAATTCTATGAATATTAA\
Edits in Original Sequence 
GCCTGCAGGAACTCGGCACGAGGCCCATCTTTAAAAAACTTGTGGAGAAGAAACAAAGCAGTAAGTT(5')ATGACCTACCTGCTAGACT
CACtCAAATGTGTTACCTGTTGGTGATGGAGCCTGTTGGGAAAACTTGTATGCTAATTTCATACCACCTAGTAATACTTTTCCAACGGAT
TATGTTCCAACGGTGTTCGATAACCTTCAGTGCAAATGTGGTGGTGGaTGGTAGCACTGTTAACCTTGGCCTATGGGATACTGCAGGACA
AGAAGACTATAACAGGCTAAGGCCATTAAGTTACAGAGGAGCTGATGTCTTTTTGCTTGCTTTTTCTCTAATTAGCAAAGCAAGCTATGA
GAACATCTACAAAAAGTGGATCCCTGAGTTAAGGCACTATGCTCCTACTATACAAATTGTTCTGGTGGGAACTAAACTTGACCTGAGGGA
AGACAAACAATATTTAAGTGATCATCCAGGGGCTACTCCTATATCAACTGCCCAGGGAGAGGAATTGAAAAAGATGATAGGAGCGGTTGC
CTACATTGAGTGTAGCTCCAAGACTCAGCAGAATGTGAAAGCTGTATTTGATACTGCNATTAANGTAGCATTGCGACCCXCCCTAGATGA
AGAAAAGGCCCCAAAXAAAGGAGGACGTTATGTGCAATTCTATGAATATTAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan