ESTScan Details for Unigene SGN-U241871

Score 
467
Direction 
Forward
Predicted Peptide Sequence 
TKVSELGETITFADVAGVDEAKEELEEIVEFLRNPDKYVRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMG
ASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGTTNRSDVLDPALRRPGRFDRVVM
VEAPD
Predicted Coding Sequence 
ACAAAAGTGTCTGAACTAGGGGAAACTATCACATTTGCTGATGTTGCAGGCGTTGACGAGGCTAAGGAGGAGCTAGAAGAAATTGTGGAA
TTTCTTAGAAATCCAGATAAGTATGTACGGCTTGGTGCACGTCCTCCTCGTGGTGTTCTACTGGTTGGTCTCCCCGGGACAGGAAAGACA
CTTCTAGCAAAGGCTGTTGCTGGGGAAGCTGAGGTTCCTTTTATCAGTTGTTCTGCAAGTGAGTTTGTAGAATTGTATGTAGGAATGGGA
GCATCACGCGTCCGTGACCTGTTTGCACGGGCAAAGAAGGAGGCACCTTCAATAATTTTTATCGATGAGATAGATGCTGTGGCAAAAAGC
CGTGATGGAAAATTCCGCATTGTAAGCAATGATGAAAGAGAGCAGACATTGAACCAACTACTCACTGAGATGGACGGATTTGACAGTAAT
TCTGCTGTAATTGTTCTTGGAACAACAAATCGCTCTGATGTCTTAGACCCTGCTCTTCGCCGACCTGGGAGATTTGACCGTGTTGTAATG
GTGGAAGCGCCTGAT\
Edits in Original Sequence 
(5')ACAAAAGTGTCTGAACTAGGGGAAACTATCACATTTGCTGATGTTGCAGGCGTTGACGAGGCTAAGGAGGAGCTAGAAGAAATTGT
GGAATTTCTTAGAAATCCAGATAAGTATGTACGGCTTGGTGCACGTCCTCCTCGTGGTGTTCTACTGGTTGGTCTCCCCGGGACAGGAAA
GACACTTCTAGCAAAGGCTGTTGCTGGGGAAGCTGAGGTTCCTTTTATCAGTTGTTCTGCAAGTGAGTTTGTAGAATTGTATGTAGGAAT
GGGAGCATCACGCGTCCGTGACCTGTTTGCACGGGCAAAGAAGGAGGCACCTTCAATAATTTTTATCGATGAGATAGATGCTGTGGCAAA
AAGCCGTGATGGAAAATTCCGCATTGTAAGCAATGATGAAAGAGAGCAGACATTGAACCAACTACTCACTGAGATGGACGGATTTGACAG
TAATTCTGCTGTAATTGTTCTTGGAACAACAAATCGCTCTGATGTCTTAGACCCTGCTCTTCGCCGACCTGGGAGATTTGACCGTGTTGT
AATGGTGGAAGCGCCTGAT\(3')AT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan