ESTScan Details for Unigene SGN-U242007

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
DSSSAAKLPSLPPQQEIGSRNVASDKVRGEQLKFHGSSSAKSSNKSSSAVQQRPVHRHNQNGVPSFPVPLAYHQSGFPPFYQSMVPMPHI
PLPGYAYQPPRGSFSGAEGHVARSDGDAASQAFVPPINGGFRPPSRGDPNDHDAKFYRGRPNTPERGSQFSSSLSNQRSVGSKDDIQLQQ
SMG
Predicted Coding Sequence 
XGTGATTCTAGTTCCGCCGCTAAGTTGCCGTCACTTCCGCCGCAGCAGGAGATTGGCAGCCGCAATGTTGCTTCTGACAAGGTCCGAGGT
GAGCAGCTAAAGTTCCATGGGTCTTCTAGTGCCAAATCTTCAAATAAGTCATCATCCGCAGTTCAACAAAGACCAGTGCATAGGCACAAC
CAAAATGGTGTGCCATCATTTCCTGTGCCCTTGGCTTACCACCAATCAGGATTCCCTCCTTTTTATCAAAGTATGGTACCTATGCCACAT
ATTCCTCTTCCAGGGTATGCATACCAGCCCCCTCGAGGGTCTTTCTCAGGAGCTGAAGGTCACGTGGCTAGGTCTGATGGTGATGCTGCA
TCTCAAGCTTTTGTACCCCCTATAAATGGTGGGTTTCGCCCCCCATCACGAGGGGATCCAAATGACCATGATGCCAAATTCTACAGAGGA
AGACCTAATACACCAGAGCGAGGTAGCCAGTTTAGTTCAAGCTTGTCTAATCAGCGATCTGTGGGTTCTAAAGATGACATTCAGCTGCAA
CAAAGTATGGGX\
Edits in Original Sequence 
(5')XGTGATTCTAGTTCCGCCGCTAAGTTGCCGTCACTTCCGCCGCAGCAGGAGATTGGCAGCCGCAATGTTGCTTCTGACAAGGTCCG
AGGTGAGCAGCTAAAGTTCCATGGGTCTTCTAGTGCCAAATCTTCAAATAAGTCATCATCCGCAGTTCAACAAAGACCAGTGCATAGGCA
CAACCAAAATGGTGTGCCATCATTTCCTGTGCCCTTGGCTTACCACCAATCAGGATTCCCTCCTTTTTATCAAAGTATGGTACCTATGCC
ACATATTCCTCTTCCAGGGTATGCATACCAGCCCCCTCGAGGGTCTTTCTCAGGAGCTGAAGGTCACGTGGCTAGGTCTGATGGTGATGC
TGCATCTCAAGCTTTTGTACCCCCTATAAATGGTGGGTTTCGCCCCCCATCACGAGGGGATCCAAATGACCATGATGCCAAATTCTACAG
AGGAAGACCTAATACACCAGAGCGAGGTAGCCAGTTTAGTTCAAGCTTGTCTAATCAGCGATCTGTGGGTTCTAAAGATGACATTCAGCT
GCAACAAAGTATGGGX\(3')GGGCTAAGGGCTTTCCTAAGGCCTCCATATTTTGGTCCAGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan