Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U242122

Score 
31
Direction 
Forward
Predicted Peptide Sequence 
AYGTLLLKFLTNGFSDGDFAGNKNDXKKHKQNMSTFXDILSSLGIVKGRNXIVLSTTKSDNLAVGSCGTQLLWMMHQIMDYSLTFEGAPI
FCDNTSAISLSKYTVHHSRANHIDIGHHFICDHVENGDFVLKFFDYENQLADIFTDPLLEELSVSFDKALALLDLIINFYTIPITFPFAD
SYRLFIKRQELLCSQSVGCHHEXPRTAPS
Predicted Coding Sequence 
GCTTATGGCACCCTTCTTCTGAAATTTTTGACTAATGGTTTTTCAGATGGAGACTTTGCAGGTAACAAAAACGATAAXAAGAAACACAAG
CAGAACATGTCAACTTTTAGXGACATTCTCTCATCTCTTGGCATAGTAAAAGGTAGAAATXCTATTGTTCTCTCAACTACTAAGTCTGAC
AATTTAGCAGTCGGAAGTTGTGGCACTCAATTACTTTGGATGATGCATCAAATTATGGATTACAGTCTAACATTTGAGGGAGCACCTATT
TTTTGTGATAACACAAGTGCTATCAGTTTATCTAAATATACTGTTCATCATTCAAGGGCAAATCATATTGATATTGGACATCATTTTATT
TGTGATCATGTTGAAAATGGTGATTTTGTTCTTAAATTTTTTGATTATGAGAATCAATTGGCAGATATATTTACCGATCCTTTACTTGAG
GAACTTTCTGTTTCCTTCGATAAAGCCTTGGCATTATTAGACTTAATCATTAATTTTTATACTATTCCTATTACTTTTCCTTTTGCAGAT
TCATACCGCCTTTTCATTAAAAGACAGGAGCTGCTCTGCTCACAATCAGTTGGTTGTCACCATGAAXCACCTCGTACTGCTCCTTCX\
Edits in Original Sequence 
(5')GCTTATGGCACCCTTCTTCTGAAATTTTTGACTAATcGGTTTTTCAGATGGAGACTTTGCAGGTAACAAAAACGATAAXAAGAAAC
ACAAGCAGAACATGTCAACTTTTAGXGACATTCTCTCATCTCTTGGCATAGTAAAAGGTAGAAATXCTATTGTTCTCTCAACTACTAAGT
CTGACAATTTAGCAGTCGGAAGTTGTGGCACTCAATTACTTTGGATGATGCATCAAATTATGGATTACAGTCTAACATTTGAGGGAGCAC
CTATTTTTTGTGATAACACAAGTGCTATCAGTTTATCTAAATATACTGTTCATCATTCAAGGGCAAATCATATTGATATTGGACATCATT
TTATTTGTGATCATGTTGAAAATGGTGATTTTGTTCTTAAATTTTTTGATTATGAGAATCAATTGGCAGATATATTTACCGATCCTTTAC
TTGAGGAACTaTTCTGTTTCCTTCGATAAAGCCTTGGCATTATTAGACTTAATCATTAATTTTTATACTATTCCTaATTACTTTTCCTTT
TGCAGATTCATACCGCCTTTTCATTAAAAGACAGGAGCTGaCTCTGCTCACAATCAGTTGGTTGTCACCATGAAXCACCTCGTACTGCTC
CTTCX\(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan