ESTScan Details for Unigene SGN-U242213

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
LLQDDIGGLQVRHQNQWIDVPPTRGALVVNIGDLLQLISNDKYISVEHRVLSNKVGPRISVPCFFSTGAFPSPRIYGPIKELLSECNPPK
YRATTVKEYTDYFRKKGFDGTSTLLDYKIPS
Predicted Coding Sequence 
CTTCTTCAAGATGATATAGGAGGTCTCCAAGTCCGTCACCAAAATCAGTGGATTGATGTTCCTCCTACACGTGGTGCTCTAGTCGTGAAT
ATTGGAGATCTGTTACAGCTCATATCGAATGACAAGTATATAAGTGTTGAGCATAGAGTATTGTCGAACAAAGTAGGTCCAAGAATATCA
GTGCCGTGTTTCTTCAGCACTGGTGCATTTCCCTCTCCAAGGATTTATGGACCAATTAAGGAATTGTTATCAGAATGTAATCCTCCAAAG
TATCGTGCAACCACAGTGAAGGAATATACAGACTATTTCCGCAAGAAAGGCTTCGATGGAACTTCTACACTGCTGGATTACAAGATCCCG
TCCTAA\
Edits in Original Sequence 
(5')CTTCTTCAAGATGATATAGGAGGTCTCCAAGTCCGTCACCAAAATCAGTGGATTGATGTTCCTCCTACACGTGGTGCTCTAGTCGT
GAATATTGGAGATCTGTTACAGCTCATATCGAATGACAAGTATATAAGTGTTGAGCATAGAGTATTGTCGAACAAAGTAGGTCCAAGAAT
ATCAGTGCCGTGTTTCTTCAGCACTGGTGCATTTCCCTCTCCAAGGATTTATGGACCAATTAAGGAATTGTTATCAGAATGTAATCCTCC
AAAGTATCGTGCAACCACAGTGAAGGAATATACAGACTATTTCCGCAAGAAAGGCTTCGATGGAACTTCTACACTGCTGGATTACAAGAT
CCCGTCCTAA\(3')AAAATTTAAGTTATTTCGTGTAAGTCATATCAAAGCTGTAAACTGAACATGTGATGTACAATTAGCTAATAAGAT
ATTCTGTAGCAAGTGGAATCACATCAGGCTTTGATGATCACCTGATATTGGATTCCATCTATTTCTTTCGAGATTGAATTCAGTGTTAGG
CATGTCGATAACCTTTAAAAGTGCAAAGGATGACTTTAATTTCATAGTCAATGTATTGAGAAAACAAACTCATTTAATCATATGTGCTAC
AGCCTATCTTCTTAAAATTTTTGGTTATTCGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan