ESTScan Details for Unigene SGN-U242350

Score 
373
Direction 
Forward
Predicted Peptide Sequence 
PSGSPALMVEHPDELNLSPEFFSFMNISLMETFRAHLSENSSRKILKWLDRLSVLIGVAKAVHFLHTGVIPSSFSNRLKTSNILLDEHNM
AKLSDFGMSILMEESEKAKGDDVTSWHMTKKEDDVYNFGFILLESLVGPSVSGKGEAFLMNEMASFGSQDGRRRIVDPIVLATSFNESLS
IVISITNKCISTXVVNS
Predicted Coding Sequence 
XXGCCTTCTGGGTCACCTGCACTGATGGTGGAGCACCCAGATGAACTCAACCTGTCCCCCGAATTTTTCTCATTTATGAATATATCTCTA
ATGGAAACCTTTCGTGCTCATCTATCAGAAAATAGTTCAAGAAAGATCCTCAAGTGGTTAGACAGGTTGTCAGTGCTGATTGGTGTTGCC
AAGGCAGTGCACTTTCTTCACACAGGTGTAATTCCTTCTTCATTTAGCAACCGCTTGAAGACGAGTAACATATTGCTTGATGAGCATAAC
ATGGCAAAACTAAGTGATTTTGGGATGTCCATTCTTATGGAAGAAAGTGAAAAGGCAAAAGGAGATGACGTCACCTCCTGGCATATGACA
AAGAAAGAGGACGATGTTTATAACTTTGGTTTCATATTACTGGAATCGCTGGTTGGCCCTTCTGTCAGTGGAAAAGGAGAAGCATTTTTG
ATGAATGAAATGGCATCCTTTGGTAGCCAAGATGGTCGACGCAGAATTGTGGATCCAATAGTGCTAGCCACTAGCTTCAATGAGTCTTTG
TCAATTGTAATATCCATCACCAACAAATGCATATCTACAGNAGTCGTCAACTCX\
Edits in Original Sequence 
(5')XXGCCTTCTGGGTCACCTGCACTGATGGTGGAGCACCCAGATGAACTCAACCTGTCCCCCGAATTTTTCTCATTTATGAATATATC
TCTAATGGAAACCTTTCGTGCTCATCTATCAGAAAATAGTTCAAGAAAGATCCTCAAGTGGTTAGACAGGTTGTCAGTGCTGATTGGTGT
TGCCAAGGCAGTGCACTTTCTTCACACAGGTGTAATTCCTTCTTCATTTAGCAACCGCTTGAAGACGAGTAACATATTGCTTGATGAGCA
TAACATGGCAAAACTAAGTGATTTTGGGATGTCCATTCTTATGGAAGAAAGTGAAAAGGCAAAAGGAGATGACGTCACCTCCTGGCATAT
GACAAAGAAAGAGGACGATGTTTATAACTTTGGTTTCATATTACTGGAATCGCTGGTTGGCCCTTCTGTCAGTGGAAAAGGAGAAGCATT
TTTGATGAATGAAATGGCATCCTTTGGTAGCCAAGATGGTCGACGCAGAATTGTGGATCCAATAGTGCTAGCCACTAGCTTCAATGAGTC
TTTGTCAATTGTAATATCCATCACCAACAAATGCATATCTACAGNAGTCGTCAACTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan