ESTScan Details for Unigene SGN-U242406

Score 
376
Direction 
Reverse
Predicted Peptide Sequence 
MESLDLEATYLKEEIEKGVQMVAINSYSPISGSNMKIIGASQHSDFSVITLLLQSSLGLQVMDKNDKKWKSVPVIKGALLVLVGDLLEVL
SNGEYKAVLHRAIRTSGNETRLSIASFQSLEMDEILEPAMKLVNEDHPEQYRGCCLRDYFKHRAFGESKPFVETVKSSIDRXWAVNWVTD
NPAPNLKTLALHA
Predicted Coding Sequence 
ATGGAAAGCTTGGATTTGGAGGCAACATATTTGAAAGAAGAAATTGAAAAAGGCGTGCAAATGGTAGCGATAAATAGCTATTCACCAATT
TCTGGATCAAACATGAAGATAATAGGTGCATCCCAACATTCAGATTTTAGCGTCATCACTCTTCTTCTGCAGAGTTCTTTAGGTCTTCAA
GTCATGGACAAAAATGATAAGAAGTGGAAATCTGTTCCTGTGATTAAAGGGGCTTTACTAGTCCTTGTTGGAGATCTTTTGGAGGTATTG
AGCAATGGTGAATACAAAGCCGTCTTGCATCGAGCAATCCGAACTTCTGGGAATGAAACTAGACTTTCTATAGCCAGTTTCCAGAGTTTG
GAAATGGATGAGATCCTTGAGCCTGCTATGAAACTTGTGAACGAAGACCATCCTGAACAGTATAGGGGCTGCTGCTTAAGAGATTATTTC
AAGCATCGTGCTTTTGGAGAATCAAAGCCCTTCGTTGAAACAGTTAAGTCATCAATTGATAGAXTTTGGGCCGTCAACTGGGTGACAGAC
AATCCGGCTCCAAACTTGAAAACCCTAGCTTTGCATGCT\
Edits in Original Sequence 
GAGGGAAATTATCAATTCAGATATGTGGAGCTATCATGGAAAGCT(5')ATGGAAAGCTTGGATTTGGAGGCAACATATTTGAAAGAAGA
AATTGAAAAAGGCGTGCAAATGGTAGCGATAAATAGCTATTCACCAATTTCTGGATCAAACATGAAGATAATAGGTGCATCCCAACATTC
AGATTTTAGCGTCATCACTCTTCTTCTGCAGAGTTCTTTAGGTCTTCAAGTCATGGACAAAAATGATAAGAAGTGGAAATCTGTTCCTGT
GATTAAAGGGGCTTTACTAGTCCTTGTTGGAGATCTTTTGGAGGTATTGAGCAATGGTGAATACAAAGCCGTCTTGCATCGAGCAATCCG
AACTTCTGGGAATGAAACTAGACTTTCTATAGCCAGTTTCCAGAGTTTGGAAATGGATGAGATCCTTGAGCCTGCTATGAAACTTGTGAA
CGAAGACCATCCTGAACAGTATAGGGGCTGCTGCTTAAGAGATTATTTCAAGCATCGTGCTTTTGGAGAATCAAAGCCCTTCGTTGAAAC
AGTTAAGaTCATCAATTGATAGAXTTTGGGCCGTCAACTGGGTGACAGACAATCCGGCTCCAAACTTGAAAACCCTAGCTTTGCATGCT\
(3')TTTGCTGCTTGCAGGTTCCTTTCGCTTTGTATTGTTTTAGTTCGCAAAAGAAGACCAAAAAAAAAACAGAGGAATTTGTCAACAAA
AGGAAGTATTTGCAACACTGACCAAGGACAGAACAGTTTCAGTCGCAAAGTAGGTGACTGCAGCTTCAATCAGCAGAACTACAGCAATAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan