Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U242440

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
AHMHSMGGPKFTHGNIKXLKRGLKQDMEACISDFGLAPIMNFPAAPSRYPGYRAPEVIESRKHSHKSDVYSFGVLLLEMLTGKQPMQSPG
RDDMVDLPRWVQSVVREEWTSEVFDVDLMRFQNIEEEMVQMLQIAMACVVKVPDMRPNMEEVVRMIEDVRQSTPKTGILQKENRSYDSNV
HIP
Predicted Coding Sequence 
GCCCACATGCATTCAATGGGTGGTCCAAAATTTACTCATGGAAATATAAAGXTCCTCAAACGTGGACTCAAGCAAGATATGGAAGCTTGC
ATCTCAGATTTTGGTTTAGCCCCTATAATGAACTTCCCTGCAGCCCCATCCCGATATCCAGGGTACCGGGCTCCTGAGGTGATAGAAAGC
CGAAAGCATAGTCATAAATCAGATGTCTACAGCTTCGGTGTGTTACTACTCGAGATGCTTACTGGTAAGCAGCCAATGCAATCACCGGGG
CGTGATGACATGGTTGACCTTCCTAGGTGGGTCCAATCAGTTGTCAGGGAGGAATGGACATCAGAGGTTTTTGACGTCGATTTGATGAGA
TTTCAAAACATTGAAGAAGAGATGGTACAAATGCTGCAAATTGCTATGGCATGTGTTGTAAAGGTCCCAGACATGCGACCCAACATGGAG
GAAGTTGTTAGAATGATTGAAGACGTCAGGCAATCAACTCCGAAAACAGGCATTCTTCAGAAAGAGAATAGATCCTATGATTCAAATGTG
CATATCCCTTGA\
Edits in Original Sequence 
(5')GCCCACATGCATTCAATGGGTGGTCCAAAATTTACTCATGGAAATATAAAGXTCCTCAAACGTGcGACTCAAGCAAGATATGGAAG
CTTGCATCTCAGATTTTGGTTTAGCCCCTATAATGAACTTCCCTGCAGCCCCATCCCGATATCCAGGGTACCGGGCTCCTGAGGTGATAG
AAAGCCGAAAGCATAGTCATAAATCAGATGTCTACAGCTTCGGTGTGTTACTACTCGAGATGCTTACTGGTAAGCAGCCAATGCAATCAC
CGGGGCGTGATGACATGGTTGACCTTCCTAGGTGGGTCCAATCAGTTGTCAGGGAGGAATGGACATCAGAGGTTTTTGACGTCGATTTGA
TGAGATTTCAAAACATTGAAGAAGAGATGGTACAAATGCTGCAAATTGCTATGGCATGTGTTGTAAAGGTCCCAGACATGCGACCCAACA
TGGAGGAAGTTGTTAGAATGATTGAAGACGTCAGGCAATCtAACTCCGAAAACAGGCATTCTTCAGAAAGAGAATAGATCCTATGATTCA
AATGTGCATATCCCTTGA\(3')ATTCCTTGGATTTCTGACTTACAATTTGCAAGTGCAGAGAAGTTCATTCGATTTCGATTACCCAGTG
CAACAACATACATGTTTTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan