ESTScan Details for Unigene SGN-U242646

Score 
190
Direction 
Forward
Predicted Peptide Sequence 
VTLLGIIIITCQYSWPTTLLLIPLGWLNVWYRGYYLATSRELTRLDSITKAPVIHHFSESISCVMTIRCFRKQEMFSQENVNRVDANLRM
DFHNNGSNEWLGFRLELLGSLLLCVSAMFMIILPSSIIKPENVGLSISYGLSLNSVLFWX
Predicted Coding Sequence 
XTTGTCACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCACACTACTTTTGATTCCTCTAGGCTGGCTAAATGTT
TGGTACCGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTTCTCTGAA
AGCATCTCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAATCTGCGA
ATGGATTTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGCAATGTTC
ATGATTATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCTATTCTGG
TXX\
Edits in Original Sequence 
(5')XTTGTCACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCACACTACTTTTGATTCCTCTAGGCTGGCTAAA
TGTTTGGTACCGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTTCTC
TGAAAGCATCTCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAATCT
GCGAATGGATTTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGCAAT
GTTCATGATTATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCTATT
CTGGTXX\(3')GT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan