ESTScan Details for Unigene SGN-U242672

Score 
209
Direction 
Forward
Predicted Peptide Sequence 
ESLNFSAEVVNLISYSYRHCPYNQASAIEMDGAAAASSPSTIKPINKSVVHRICAGQVILDLPSAVKELVENSLDAGATSIEVSLKDYGS
ESFQVIDNGCGISPQNFKVLALKHHTSKLSDFPDLQSLVTFGFRGEALSSLCALGDLTVETRTKNEQIATHLTFDHSGLLIAERNIARQV
GTTVTVKKLFSTLPVRSKEFHRNIRKEYGKLITLLNAYALISKGVRLVCTNSAXKNAKSVVL
Predicted Coding Sequence 
XXTGAATCACTGAATTTCTCAGCTGAAGTAGTAAACTTGATATCTTACAGTTACCGGCATTGCCCCTACAATCAAGCGAGCGCCATTGAA
ATGGACGGAGCAGCAGCAGCTTCTTCACCGTCGACTATTAAACCCATAAACAAGAGCGTAGTCCATAGAATTTGTGCGGGTCAAGTTATT
CTGGACCTTCCCTCTGCCGTCAAGGAATTGGTTGAAAATAGCTTGGACGCCGGAGCTACCAGCATCGAAGTCTCCCTCAAAGACTATGGT
TCTGAATCCTTCCAGGTCATTGATAACGGTTGTGGCATCTCGCCTCAAAATTTCAAGGTATTGGCGCTAAAACATCATACCTCAAAACTA
TCAGATTTTCCTGATCTTCAGTCATTAGTGACTTTTGGATTTAGAGGGGAGGCATTGAGTTCACTTTGTGCTTTAGGGGATTTGACAGTT
GAAACAAGAACAAAGAATGAGCAAATTGCGACACACTTGACTTTTGATCATTCGGGCCTTCTGATAGCTGAAAGGAACATAGCTCGCCAA
GTTGGTACCACTGTCACTGTTAAGAAGTTGTTCTCCACTTTACCAGTGAGAAGTAAAGAATTCCACCGCAATATCCGGAAGGAATATGGA
AAGCTTATCACATTGCTGAATGCCTATGCTCTTATTTCTAAGGGAGTCAGACTAGTTTGTACCAACTCAGCTXCTAAAAATGCAAAATCT
GTAGTTCTG\
Edits in Original Sequence 
(5')XXTGAATCACTGAATTTCTCAGCaTGAAGTAGTAAACTTGATATCTTACAGTTACCGGCATTGCCCCTACAATCAAGCGAGCGCCA
TTGAAATGGACGGAGCAGCAGCAGCTTCTTCACCGTCGACTATTAAACCCATAAACAAGAGCGTAGTCCATAGAATTTGTGCGGGTCAAG
TTATTCTGGACCTTCCCTCTGCCGTCAAGGAATTGGTTGAAAATAGCTTGGACGCCGGAGCTACCAGCATCGAAGTCTCCCTCAAAGACT
ATGGTTCTGAATCCTTCCAGGTCATTGATAACGGTTGTGGCATCTCGCCTCAAAATTTCAAGGTATTGGCGCTAAAACATCATACCTCAA
AACTATCAGATTTTCCTGATCTTCAGTCATTAGTGACTTTTGGATTTAGAGGGGAGGCATTGAGTTCACTTTGTGCTTTAGGGGATTTGA
CAGTTGAAACAAGAACAAAGAATGAGCAAATTGCGACACACTTGACTTTTGATCATTCGGGCCTTCTGATAGCTGAAAGGAACATAGCTC
GCCAAGTTGGTACCACTGTCACTGTTAAGAAGTTGTTCTCCACTTTACCAGTGAGAAGTAAAGAATTCCACCGCAATATCCGGAAGGAAT
ATGGAAAGCTTATCACATTGCTGAATGCCTATGCTCTTATTTCTAAGGGAGTCAGACTAGTTTGTACCAACTCAGCTXCTAAAAATGCAA
AATCTGTAGTTCTG\(3')TG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan