Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U242760

Score 
304
Direction 
Forward
Predicted Peptide Sequence 
NGLCKLKTSDDVMETFKXHGGKRVRPKYNPYNILIESLCKSRKLMKALELLEDIQNRGLIPDTVSCGTLINGFCENEDLDGAYELFRRMR
RQYKYFHTTATYNIMISAFSKKLKMDMADKLFLEMNECGCPPDSYTYRCMIDGFCKVDNTEFGYKFLLENFSKELLPSKETAGQVINCLC
V
Predicted Coding Sequence 
XXGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTGATGGAAACCTTCAAAGXTCATGGTGGAAAAAGGGTGCGTCCCAAATATAAT
CCATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGAGGATATTCAAAACAGGGGTCTT
ATTCCTGATACAGTGAGTTGTGGCACTCTGATAAATGGGTTTTGTGAGAATGAGGATTTGGATGGAGCTTATGAGCTATTCAGAAGAATG
AGAAGGCAATATAAGTATTTTCATACTACTGCAACATACAATATAATGATCAGTGCATTTTCTAAAAAGCTGAAAATGGACATGGCAGAT
AAGCTTTTTCTTGAGATGAATGAATGTGGCTGTCCTCCTGACAGCTACACATACCGTTGTATGATAGATGGTTTCTGCAAGGTCGACAAT
ACTGAATTTGGATACAAGTTTTTGCTTGAAAACTTTTCGAAAGAACTTCTTCCATCAAAAGAAACAGCGGGACAAGTGATCAATTGCCTA
TGTGTG\
Edits in Original Sequence 
(5')XXGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTGATGGAAACCTTCAAAGXTCATGGTGGAAAAAGGGTGCGTCCCAAATA
TAATCaCATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGAGGATATTCAAAACAGGG
GTCTTATTCCTGATACAGTGAGTTGTGGCACTCTGATAAATGGGTTTTGTGAGAATGAGGATTTGGATGGAGCTTATGAGCTATTCAGAA
GAATGAGAAGGCAATATAAGTATTTTCATACTACTGCAACATACAATATAATGATCAGTGCATTTTCTAAAAAGCTGAAAATGGACATGG
CAGATAAGCTTTTTCTTGAGATGAATGAATGTGGCTGTCCTCCTGACAGCTACACATACCGTTGTATGATAGATGGTTTCTGCAAGGTCG
ACAATACTGAATTTGGATACAAGTTTTTGCTTGAAAACTTTTCGAAAGAACTTCTTCCATCAAAAGAAACAGCGGGACAAGTGATCAATT
GCCTATGTGTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan