ESTScan Details for Unigene SGN-U242805

Score 
306
Direction 
Reverse
Predicted Peptide Sequence 
PPFKVYISLCDMYARANVKKKALQALGVLEAKQEQLEPEDFERIIWSLIAGGFVQDAQKFQGLMKARGFTVSEQLQVTLMASQTFLRRRP
SVR
Predicted Coding Sequence 
XXTCCTCCATTCAAGGTTTATATTAGCCTATGTGACATGTATGCAAGAGCTAATGTTAAGAAAAAGGCTCTTCAAGCTCTTGGAGTTTTG
GAGGCAAAACAAGAGCAATTGGAACCAGAAGATTTCGAGAGGATTATATGGTCGCTTATAGCTGGTGGATTTGTACAAGATGCTCAAAAG
TTCCAAGGATTGATGAAAGCTCGGGGATTTACAGTGTCTGAGCAACTTCAAGTGACACTCATGGCGTCTCAAACTTTTCTTCGCAGAAGA
CCATCTGTAAGATAA\
Edits in Original Sequence 
(5')XXTCCTCCATTCAAGGTTTATATTAGCCTATGTGACATGTATGCAAGAGCTAATGTTAAGAAAAAGGCTCTTCAAGCTCTTGGAGT
TTTGGAGGCAAAACAAGAGCAATTGGAACCAGAAGATTTCGAGAGGATTATATGGTCGCTTATAGCTGGTGGATTTGTACAAGATGCTCA
AAAGTTCCAAGGATTGATGAAAGCTCGGGGATTTACAGTGTCTGAGCAACTTCAAGTGACACTCATGGCGTCTCAAACTTTTCTTCGCAG
AAGACCATCTGTAAGATAA\(3')TGTTGATCGCTTGCATAAAAAAACTTTTTGCGTGGTGAGATGTGGTGATTAGAGGACAGGTGAATT
GCTATCACTGATTCCTAGATTATTTTATGGAACATTATATATTAATTTAATGTTGTAAATAATAAATCATTCAGTATAGCTGATCCAGAT
GATTAGCTGTTTTACTAGTAGTAATGGATGTTCCATTGCTGTGTCTATAAGAAATGGTTTAGGTAATTTCACATGGTATAGTAAAATGAA
AATTTCTGTGGTGCTTAGCCCTATTTGTGCTGCAGAGAATGTTTATATCTCGCCATGTGTGTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan