ESTScan Details for Unigene SGN-U242807

Score 
467
Direction 
Forward
Predicted Peptide Sequence 
ETSSHFMKWVEAPAPVGGGGGPDWCAKHIKAVMNIGGPLLGVPKSIAGLFSAEARDIAVARALAPGVLDTDMFHLQTLEHIMKMSRTWDA
TMSMNQEEGTRSGAVLNGHPKKAILLAEXKSRDDAAQNSRHHENQTTDSKAKYYSYGRMMSFGKDAAEAHPSDLKKIDFXDAVKGSNVAN
NTCDVX
Predicted Coding Sequence 
XXCGAGACTAGTTCTCATTTTATGAAGTGGGTGGAGGCACCAGCTCCTGTGGGTGGTGGTGGTGGACCCGATTGGTGCGCCAAGCACATT
AAAGCTGTGATGAATATTGGTGGGCCATTGCTAGGTGTTCCAAAATCTATAGCTGGCCTTTTCTCAGCTGAAGCACGGGATATTGCTGTT
GCCAGGGCTCTGGCTCCAGGTGTTCTGGACACGGATATGTTCCATCTTCAAACATTAGAGCACATAATGAAGATGTCACGAACCTGGGAT
GCAACCATGTCAATGAACCAAGAGGAGGGGACACGATCTGGGGCGGTCTTGAATGGTCACCCGAAGAAGGCTATTCTCCTTGCAGAAGXT
AAGTCCAGAGACGATGCTGCTCAGAATTCAAGACATCACGAGAATCAAACTACAGATTCTAAAGCAAAATATTACAGTTATGGAAGGATG
ATGTCCTTTGGAAAGGATGCAGCAGAAGCTCATCCATCAGATCTTAAGAAGATTGACTTCANGGATGCTGTTAAAGGCAGTAATGTTGCA
AATAACACCTGTGATGTGTXX\
Edits in Original Sequence 
(5')XXCGAGACTAGTTCTCATTTTATGAAGTGGGTGGAGGCACCAGCTCCTGTGGGTGGTGGTGGTGGACCCGATTGGTGCGCCAAGCA
CATTAAAGCTGTGATGAATATTGGTGGGCCATTGCTAGGTGTTCCAAAATCTATAGCTGGCCTTTTCTCAGCTGAAGCACGGGATATTGC
TGTTGCCAGGGCTCTGGCTCCAGGTGTTCTGGACACGGATATGTTCCATCTTCAAACATTAGAGCACATAATGAAGATGTCACGAACCTG
GGATGCAACCATGTCAATGAtACCAAGAGGAGGGGACACGATCTGGGGCGGTCTTGAATGGTCACCCGAAGAAGGCTATTCTCCTTGCAG
AAGXTAAGTCCAGAGACGATGCTGCTCAGAATTCAAGACATCACGAGAATCAAACTACAGATTCTAAAGCAAAATATTACAGTTATGGAA
GGATGATGTCCTTTGGAAAGGATGCAGCAGAAGCTCATCCATCAGATCTTAAGAAGATTGACTTCANGGATGCTGTTAAAGGCAGTAATG
TTGCAAATAACACCTGTGATGTGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan