ESTScan Details for Unigene SGN-U242819

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
VESYLLESLIKSAIRRVDAGVTVAMAEALAIAVGKYTYVHEVGKGPPEAIDAHHIVVRRSREKGFNXMPIYSSPFCLSHLSVIPAGKARY
SSYLELSYHDIAYEVISKEAVKKESVLILPAFGVQLETQYGSGKTVRQFVPISRILKPVLTECVTPITCYWSLSLIIRGEEELMLVFKEL
RPPVKMLAPIWKALCAAIECGECTETIT
Predicted Coding Sequence 
XCCGTTGAGAGTTATCTTCTTGAATCCCTGATCAAATCTGCAATTCGTCGAGTTGATGCCGGAGTAACAGTGGCXATGGCGGAGGCATTG
GCCATTGCAGTAGGAAAATACACATACGTACATGAAGTGGGTAAAGGCCCACCTGAAGCCATTGACGCTCACCATATTGTGGTTCGAAGG
AGTAGAGAAAAGGGTTTCAATTTXATGCCTATTTACTCTTCTCCTTTTTGCCTATCCCACCTTTCTGTTATTCCGGCAGGGAAAGCTAGA
TACTCTTCATATTTGGAGCTTAGTTATCATGACATTGCTTATGAGGTTATTTCTAAAGAAGCAGTTAAGAAAGAGTCTGTTCTAATTCTT
CCAGCTTTTGGAGTTCAACTTGAGACTCAGTATGGAAGTGGGAAAACAGTTCGCCAGTTTGTCCCCATCAGCAGGATTTTGAAACCAGTG
CTGACAGAATGTGTCACACCAATCACCTGTTATTGGAGTCTGTCTTTGATTATTCGAGGAGAGGAAGAACTTATGCTAGTATTCAAGGAA
TTACGTCCACCAGTGAAGATGTTAGCGCCCATCTGGAAGGCTTTATGTGCTGCCATTGAATGTGGAGAATGCACGGAGACGATTACATAG
\
Edits in Original Sequence 
(5')XCCGTTGAGAGTTATCTTCTTGAATCCCTGATCAAATCTGCAATTCGTCGAcGTTGATGCCGGAGTAACAGTGGCXATGGCGGAGG
CATTGGCCATTGCAGTAGGAAAATACACATACGTACATGAAGTGGGTAAAGGCCCACCTGAAGCCATTGACGCTCACCATATTGTGGTTC
GAAGGAGTAGAGAAAAGGGTTTCAATTTXATGCCTATTTACTCTTCTCCTTTTTGCCTATCCCACCTTTCTGTTATTCCGGCAGGGAAAG
CTAGATACTCTTCATATTTGGAGCTTAGTTATCATGACATTGCTTATGAGGTTATTTCTAAAGAAGcCAGTTAAGAAAGAGTCTGTTCTA
ATTCTTCCAGCTTTTGGAGTTCAACTTGAGACTCAGTATGGAAGTGGGAAAACAGTTCGCCAGTTTGTCCCCATCAGCAGGATTTTGAAA
CCAGTGCTGACAGAATGTGTCACACCAATCACCTGTTATTGGAGTCTGTCTTTGATTATTCGAGGAGAGGAAGAACTTATGCTAGTATTC
AAGGAATTACGTCCACCAGTGAAGATGTTAGCGCCCATCTGGAAGGCTTTATGTGCTGCCATTGAATGTGGAGAATGCACGGAGACGATT
ACATAG\(3')AGATTGTAATAGTATAATCTCAACCAATTCAATTCTAGTATAAATTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan