ESTScan Details for Unigene SGN-U242865

Score 
233
Direction 
Forward
Predicted Peptide Sequence 
IYMWTPSGAYCINVPLPQFAVIDLKWNSDGSCLFLKDKESFCCASPEILQESSDYSSDDDASIITHYETXMELKSFVHHTSQSEYPFVKA
TALLAYYFSVCTIDRKKR
Predicted Coding Sequence 
XACATATACATGTGGACACCTTCAGGTGCTTATTGCATAAATGTTCCATTGCCTCAATTTGCGGTAATTGATCTGAAATGGAACTCCGAT
GGGAGCTGTCTTTTTCTCAAAGACAAGGAGTCATTCTGCTGTGCTTCTCCGGAGATACTGCAAGAATCCAGTGATTATAGCTCTGATGAT
GATGCTTCCATCATCACACATTATGAAACTTTXATGGAGCTGAAATCTTTTGTTCATCACACCTCCCAAAGTGAGTATCCCTTCGTCAAG
GCGACAGCTTTGCTTGCTTATTATTTTTCAGTTTGCACTATTGACAGGAAGAAGAGGTAA\
Edits in Original Sequence 
(5')XACATATACATGTGGACACCTTCAGGTGCTTATTGCATAAATGTTCCATTGCCTCAATTTGCGGTAATTGATCTGAAATGGAACTC
CGATGGGAGCTGTCTTTTTCTCAAAGACAAGGAGTCATTCTGCTGTGCTTCTCCGGAGATACTGCAAGAATCCAGTGATTATAGCTCTGA
TGAtTGATGCTTCCATCATCACACATTATGAAACTTTXATGGAGCTGAAATCTTTTGTTCATCACACCTCCCAAAGTGAGTATCCCTTCG
TCAAGGCGACAGCTTTGCTTGCTTATTATTTTTCAGTTTGCACTATTGACAGGAAGAAGAGGTAA\(3')AATCTAAGGCTGTGATAATC
TTGTTTATTTGCTTTCTAATGGTGTATATTTGAGATCCAAAATAGTAGGACGGATTTTAGAAATCTGGATTTGTAACATTATCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan