ESTScan Details for Unigene SGN-U242926

Score 
299
Direction 
Forward
Predicted Peptide Sequence 
VHNSLLSLLMKRSRVDEAVDFFKHHILRSERLFPDTCTFNTVIRGLCRVGGVDKAFEFFNDMGSFGCSPDTVTYNTLINGLCAVGQVNRA
QGLLGNLQLQDGLSPDVVTYTSLISGYCKLSRMDEAINLMDEMITYGISPNLVTFNISY
Predicted Coding Sequence 
XTTGTACATAATAGTCTTTTGAGTTTGTTAATGAAACGAAGTAGGGTAGATGAAGCTGTTGATTTTTTCAAACATCATATTTTGAGGTCA
GAGAGATTGTTCCCAGATACCTGCACTTTTAACACTGTGATTCGTGGGCTTTGTCGAGTTGGAGGAGTTGACAAGGCATTTGAGTTTTTC
AATGACATGGGAAGTTTTGGTTGTTCCCCTGATACTGTTACTTATAACACTCTTATAAATGGGTTGTGTGCTGTTGGTCAAGTAAACAGA
GCGCAAGGTCTGTTAGGAAATCTTCAGTTACAAGATGGACTGTCACCTGATGTTGTGACATATACTTCTCTTATCTCTGGGTACTGCAAG
TTGAGCAGGATGGATGAGGCTATAAATCTGATGGATGAAATGATTACTTATGGTATTAGTCCAAATCTAGTTACTTTTAACATTTCTTAT
TAA\
Edits in Original Sequence 
(5')XTTGTACATAATAGTCTTTTGAGTTTGTTAATGAAACGAAGTAGGGTAGATGAAGCTGTTGATTTTTTCAAACATCATATTTTGAG
GTCAGAGAGATTGTTCCCAGATACCTGCACTTTTAACACTGTGATTCGTGGGCTTTGTCGAGTTGGAGGAGTTGACAAGGCATTTGAGTT
TTTCAATGACATGGGAAGTTTTGGTTGTTCCCCTGATACTGTTACTTATAACACTCTTATAAATGGGTTGTGTGCTGTTGGTCAAGTAAA
CAGAGCGCAAGGTCTGTTAGGAAATCTTCAGTTACAAGATGGACTGTCACCTGATGTTGTGACATATACTTCTCTTATCTCTGGGTACTG
CAAGTTGAGCAGGATGGATGAGGCTATAAATCTGATGGATGAAATGATTACTTATGGTATTAGTCCAAATCTAGTTACTTTTAACATTTC
TTATTAA\(3')ATGGTTTGGGAAGATAGGAGACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan